| Clone Name | rbags19f11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | FABG_BUCAP (Q8K9J5) 3-oxoacyl-[acyl-carrier-protein] reductase (... | 33 | 0.60 | 2 | NMT1_ARATH (Q9LTR9) Glycylpeptide N-tetradecanoyltransferase 1 (... | 32 | 1.3 | 3 | TOLB_ERWCT (Q6D7F2) Protein tolB precursor | 30 | 3.0 | 4 | IBP5_XENLA (Q90WV8) Insulin-like growth factor-binding protein 5... | 30 | 5.0 | 5 | ZN580_MOUSE (Q9DB38) Zinc finger protein 580 | 29 | 8.6 |
|---|
>FABG_BUCAP (Q8K9J5) 3-oxoacyl-[acyl-carrier-protein] reductase (EC 1.1.1.100)| (3-ketoacyl-acyl carrier protein reductase) Length = 244 Score = 32.7 bits (73), Expect = 0.60 Identities = 27/77 (35%), Positives = 35/77 (45%), Gaps = 4/77 (5%) Frame = +3 Query: 15 TVPXLIGFLNPRLFTEKTGNNSGLIVQHKPRACSVVCKGSDLR----GFGMQ*YTKKLVT 182 T+ +IG+L R + + SGLI HK A V KG + GF TK L Sbjct: 135 TIGSVIGYLGNRGQINYSASKSGLIGFHKSLALEVAQKGITVNIVSPGFIKTNLTKNL-- 192 Query: 183 RQKFGLEKYTSKAPFKR 233 F +K+ SK P KR Sbjct: 193 -NVFQYKKHLSKIPMKR 208
>NMT1_ARATH (Q9LTR9) Glycylpeptide N-tetradecanoyltransferase 1 (EC 2.3.1.97)| (Peptide N-myristoyltransferase 1) (Myristoyl-CoA:protein N-myristoyltransferase 1) (NMT 1) (Type I N-myristoyltransferase 1) Length = 434 Score = 31.6 bits (70), Expect = 1.3 Identities = 21/66 (31%), Positives = 32/66 (48%) Frame = -1 Query: 304 SDFEANPIVDGQWLLPCAVDIDSFLLKGALLVYFSKPNFCLVTNFLVYYCIPNPRRSEPL 125 +DF+ N + WLLP +DS+L++ P VT+F +Y +P+ P Sbjct: 300 TDFDENDVE--HWLLPREDVVDSYLVES--------PETHDVTDFCSFYTLPSTILGNPN 349 Query: 124 QTTLHA 107 TTL A Sbjct: 350 YTTLKA 355
>TOLB_ERWCT (Q6D7F2) Protein tolB precursor| Length = 430 Score = 30.4 bits (67), Expect = 3.0 Identities = 18/50 (36%), Positives = 27/50 (54%) Frame = +1 Query: 163 TPKNWSLDRSLA*KNTQARHLSRGSYLYPLRMVTTTGHPRSGLLQNQTKI 312 TP W+ A Q + + GSYL ++V T+G+P + L QNQ K+ Sbjct: 87 TPAAWTALGIDAVVVGQVQPSADGSYLVSYQLVDTSGNPGNVLAQNQFKV 136
>IBP5_XENLA (Q90WV8) Insulin-like growth factor-binding protein 5 precursor| (IGFBP-5) (IBP-5) (IGF-binding protein 5) (xIGFBP-5) Length = 265 Score = 29.6 bits (65), Expect = 5.0 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = -1 Query: 157 CIPNPRRSEPLQTTLHARGLCCTIK 83 C+P +PL LH RG+C +K Sbjct: 81 CLPEQGEEKPLHALLHGRGVCLNLK 105
>ZN580_MOUSE (Q9DB38) Zinc finger protein 580| Length = 172 Score = 28.9 bits (63), Expect = 8.6 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = +1 Query: 301 QTKINPGEPQTLTGYRSPSCSRVLIS 378 Q + PGEP GY P C+RV S Sbjct: 78 QREATPGEPGPRKGYSCPECARVFAS 103 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 79,572,846 Number of Sequences: 219361 Number of extensions: 1677678 Number of successful extensions: 3460 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 3401 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3460 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3812186532 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)