| Clone Name | rbags19f05 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | RFAZ_SALTY (P26473) Lipopolysaccharide core biosynthesis protein... | 30 | 2.9 | 2 | ILVC_BUCAI (P57655) Ketol-acid reductoisomerase (EC 1.1.1.86) (A... | 28 | 8.6 |
|---|
>RFAZ_SALTY (P26473) Lipopolysaccharide core biosynthesis protein rfaZ| Length = 269 Score = 29.6 bits (65), Expect = 2.9 Identities = 23/70 (32%), Positives = 31/70 (44%), Gaps = 1/70 (1%) Frame = +1 Query: 88 IQKRINKMLWITTPDNKVKKNRQNRNGIVQTSISICSCH*NVY-AIR*TSRLSGAILATS 264 I KR++K L I+ P + K + SI CSCH Y AI+ L + S Sbjct: 135 ILKRVHKALLISVP---LSKRGRLAGFCKDISIGYCSCHTIAYTAIQVAYSLKYGRIICS 191 Query: 265 RCRATGECPQ 294 TG CP+ Sbjct: 192 GLDLTGSCPR 201
>ILVC_BUCAI (P57655) Ketol-acid reductoisomerase (EC 1.1.1.86)| (Acetohydroxy-acid isomeroreductase) (Alpha-keto-beta-hydroxylacil reductoisomerase) Length = 490 Score = 28.1 bits (61), Expect = 8.6 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +3 Query: 312 KFHHQTIRKVQREKKKNRRGGYTQG 386 K HH I+K+Q+ KKN GY+ G Sbjct: 108 KQHHSVIKKLQKLMKKNAVLGYSHG 132 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 61,897,853 Number of Sequences: 219361 Number of extensions: 1245195 Number of successful extensions: 3376 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3294 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3376 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2228238148 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)