| Clone Name | rbags18o23 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | HGD_LEGPL (Q5WX50) Homogentisate 1,2-dioxygenase (EC 1.13.11.5) ... | 31 | 1.5 | 2 | HGD_LEGPH (Q9S4T0) Homogentisate 1,2-dioxygenase (EC 1.13.11.5) ... | 31 | 1.5 | 3 | HGD_LEGPA (Q5X5S2) Homogentisate 1,2-dioxygenase (EC 1.13.11.5) ... | 31 | 1.5 | 4 | RM47_MOUSE (Q8K2Y7) 39S ribosomal protein L47, mitochondrial pre... | 29 | 4.4 |
|---|
>HGD_LEGPL (Q5WX50) Homogentisate 1,2-dioxygenase (EC 1.13.11.5)| (Homogentisicase) (Homogentisate oxygenase) (Homogentisic acid oxidase) Length = 416 Score = 30.8 bits (68), Expect = 1.5 Identities = 13/28 (46%), Positives = 15/28 (53%) Frame = -2 Query: 341 HTPLRAHCWHINYLPFLSYLSPFKTYTT 258 H+PL WH NY P+ LS F T T Sbjct: 243 HSPLNVVAWHGNYAPYCYDLSLFNTINT 270
>HGD_LEGPH (Q9S4T0) Homogentisate 1,2-dioxygenase (EC 1.13.11.5)| (Homogentisicase) (Homogentisate oxygenase) (Homogentisic acid oxidase) Length = 416 Score = 30.8 bits (68), Expect = 1.5 Identities = 13/28 (46%), Positives = 15/28 (53%) Frame = -2 Query: 341 HTPLRAHCWHINYLPFLSYLSPFKTYTT 258 H+PL WH NY P+ LS F T T Sbjct: 243 HSPLNVVAWHGNYAPYCYDLSLFNTINT 270
>HGD_LEGPA (Q5X5S2) Homogentisate 1,2-dioxygenase (EC 1.13.11.5)| (Homogentisicase) (Homogentisate oxygenase) (Homogentisic acid oxidase) Length = 416 Score = 30.8 bits (68), Expect = 1.5 Identities = 13/28 (46%), Positives = 15/28 (53%) Frame = -2 Query: 341 HTPLRAHCWHINYLPFLSYLSPFKTYTT 258 H+PL WH NY P+ LS F T T Sbjct: 243 HSPLNVVAWHGNYAPYCYDLSLFNTINT 270
>RM47_MOUSE (Q8K2Y7) 39S ribosomal protein L47, mitochondrial precursor (L47mt)| (MRP-L47) Length = 252 Score = 29.3 bits (64), Expect = 4.4 Identities = 19/42 (45%), Positives = 25/42 (59%) Frame = -1 Query: 216 ILLRIRMHSCRWLVKKSLEKGKEKIAQIRKCEKITQERKSEN 91 I LRI H+ K+SL+K KEKI K ++QERKS + Sbjct: 211 IRLRIEKHARIEARKRSLQKKKEKILH-AKFPHLSQERKSSS 251 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 51,315,545 Number of Sequences: 219361 Number of extensions: 818550 Number of successful extensions: 1483 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1471 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1483 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2570413340 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)