| Clone Name | rbags19d04 |
|---|---|
| Clone Library Name | barley_pub |
>PCSK6_RAT (Q63415) Proprotein convertase subtilisin/kexin type 6 precursor| (EC 3.4.21.-) (Paired basic amino acid cleaving enzyme 4) (Subtilisin/kexin-like protease PACE4) (Subtilisin-like proprotein convertase 4) (SPC4) Length = 937 Score = 32.7 bits (73), Expect = 0.94 Identities = 19/48 (39%), Positives = 22/48 (45%) Frame = -3 Query: 315 PRPWRQGPRGSWRLQRRIRWRGLSQPAACSGNPGPEPVPNPRWEVRLL 172 PRPWR W L L+ PA CS P P PV W V++L Sbjct: 28 PRPWR------WLLL-------LALPAVCSALPPPRPVYTNHWAVQVL 62
>PCSK6_HUMAN (P29122) Proprotein convertase subtilisin/kexin type 6 precursor| (EC 3.4.21.-) (Paired basic amino acid cleaving enzyme 4) (Subtilisin/kexin-like protease PACE4) (Subtilisin-like proprotein convertase 4) (SPC4) Length = 969 Score = 30.8 bits (68), Expect = 3.6 Identities = 20/48 (41%), Positives = 23/48 (47%) Frame = -3 Query: 315 PRPWRQGPRGSWRLQRRIRWRGLSQPAACSGNPGPEPVPNPRWEVRLL 172 PRPWR W L L+ PAACS P P PV W V++L Sbjct: 46 PRPWR------WLLL-------LALPAACSAPP-PRPVYTNHWAVQVL 79
>TCL2_CAEEL (Q9N428) T-cell defective protein 2| Length = 435 Score = 30.8 bits (68), Expect = 3.6 Identities = 12/35 (34%), Positives = 23/35 (65%) Frame = -2 Query: 529 SLKRGRSKLIRIFRLCNYFPPRKEMMRFSSNWVLI 425 +LK + K +RI++L + P+KE+ +S W++I Sbjct: 341 ALKEAKEKEMRIWKLAPFETPKKEVPLYSGRWLVI 375
>HXA3_HETFR (Q9IA21) Homeobox protein Hox-A3| Length = 410 Score = 29.6 bits (65), Expect = 8.0 Identities = 23/83 (27%), Positives = 29/83 (34%), Gaps = 10/83 (12%) Frame = +2 Query: 119 LNLTESAILIKGWYSRRHSN----------LTSHRGLGTGSGPGLPEQAAGCDNPRHRIR 268 LNLTE I I W+ R LTS G P P A G N H + Sbjct: 205 LNLTERQIKI--WFQNRRMKYKKDQKAKGMLTSSGGQSPCRSPIPPSAAGGYANSMHSLA 262 Query: 269 L*SLHDPRGPCRHGLGHHRTFLL 337 + +DP P H + + Sbjct: 263 TSAPYDPHSPTSFSKPHQNAYAI 285
>GDF6_BOVIN (P55106) Growth/differentiation factor 6 precursor (GDF-6)| (Cartilage-derived morphogenetic protein 2) (CDMP-2) (Fragment) Length = 436 Score = 29.6 bits (65), Expect = 8.0 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -3 Query: 240 PAACSGNPGPEPVPNPRWEV 181 PAA S PGP P P WEV Sbjct: 168 PAAGSAEPGPAGAPRPGWEV 187
>KCY_PYRHO (O58988) Cytidylate kinase (EC 2.7.4.14) (CK) (Cytidine| monophosphate kinase) (CMP kinase) Length = 192 Score = 29.6 bits (65), Expect = 8.0 Identities = 13/41 (31%), Positives = 25/41 (60%) Frame = -1 Query: 578 FEKVMEEKRKALDALKKSEERKVEIDKDLQAMQLLSTKKGN 456 F ++ +EK +L+ +K E EID+++ Q+ + K+GN Sbjct: 40 FRQMAKEKGMSLEEFQKYAELHPEIDREVDRRQIEAAKEGN 80
>Y157_AQUAE (O66547) Hypothetical protein aq_157 precursor| Length = 162 Score = 29.6 bits (65), Expect = 8.0 Identities = 13/27 (48%), Positives = 21/27 (77%) Frame = -1 Query: 578 FEKVMEEKRKALDALKKSEERKVEIDK 498 ++K+++EK+K L+ALKKS E K +K Sbjct: 53 YQKLIQEKQKKLEALKKSLESKALSEK 79 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 72,131,822 Number of Sequences: 219361 Number of extensions: 1429052 Number of successful extensions: 4943 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 4538 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4936 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6029593548 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)