| Clone Name | rbags19c17 |
|---|---|
| Clone Library Name | barley_pub |
>SRRM1_CHICK (Q5ZMJ9) Serine/arginine repetitive matrix protein 1| Length = 888 Score = 29.6 bits (65), Expect = 3.1 Identities = 12/24 (50%), Positives = 17/24 (70%) Frame = -3 Query: 352 KQREDNREQAEQGRRPRRAAHRSP 281 K+ +DNRE+ ++ R PRR RSP Sbjct: 156 KEDKDNREKRDRSRSPRRRKSRSP 179
>FILA_MOUSE (P11088) Filaggrin (Fragment)| Length = 336 Score = 29.3 bits (64), Expect = 4.0 Identities = 14/46 (30%), Positives = 22/46 (47%) Frame = -3 Query: 394 ERASELQGRSCHGHKQREDNREQAEQGRRPRRAAHRSPG*DAFRSR 257 +R + Q + H H+Q E Q + R + AH+ G D+ R R Sbjct: 175 QRGHQHQHQHQHEHEQPESGHRQQQSSGRGHQGAHQEQGRDSARPR 220
>CD2L2_HUMAN (Q9UQ88) PITSLRE serine/threonine-protein kinase CDC2L2 (EC| 2.7.11.22) (Galactosyltransferase-associated protein kinase p58/GTA) (Cell division cycle 2-like protein kinase 2) (CDK11) Length = 780 Score = 28.9 bits (63), Expect = 5.3 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = -3 Query: 394 ERASELQGRSCHGHKQREDNREQAEQGRRPRRAAHR 287 +R +L+ + K RE +EQ EQ R RRA R Sbjct: 154 DRLEQLERKRERERKMREQQKEQREQKERERRAEER 189
>CAND_DROME (P27398) Calpain D (EC 3.4.22.-) (Calcium-activated neutral| proteinase D) (CANP D) (Small optic lobes protein) Length = 1594 Score = 28.9 bits (63), Expect = 5.3 Identities = 13/41 (31%), Positives = 18/41 (43%) Frame = -3 Query: 418 VWYECGGGERASELQGRSCHGHKQREDNREQAEQGRRPRRA 296 +W + L G SC G + D E ++G RPR A Sbjct: 1206 IWAQLLSSRCVRFLMGASCGGGNMKVDEEEYQQKGLRPRHA 1246
>CD2L1_HUMAN (P21127) PITSLRE serine/threonine-protein kinase CDC2L1 (EC| 2.7.11.22) (Galactosyltransferase-associated protein kinase p58/GTA) (Cell division cycle 2-like protein kinase 1) (CLK-1) (CDK11) (p58 CLK-1) Length = 795 Score = 28.9 bits (63), Expect = 5.3 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = -3 Query: 394 ERASELQGRSCHGHKQREDNREQAEQGRRPRRAAHR 287 +R +L+ + K RE +EQ EQ R RRA R Sbjct: 166 DRLEQLERKRERERKMREQQKEQREQKERERRAEER 201
>DCR1_SCHPO (Q09884) Cell cycle control protein dcr1 (EC 3.6.1.-)| (ATP-dependent helicase dcr1) (RNA interference pathway protein dcr1) Length = 1374 Score = 28.5 bits (62), Expect = 6.9 Identities = 20/60 (33%), Positives = 34/60 (56%) Frame = -1 Query: 426 LRKYGMNVVVANELANYKDVVVMVTSSGKTTVSRRSKEDDLEEQLIGLLVKMHSDHAKQS 247 LRKY +V N + ++VM T +GKT ++ + + LEEQ+ L+ + + +H K S Sbjct: 12 LRKYQQDVY--NIASKQNTLLVMRTGAGKTLLAVKLIKQKLEEQI--LIQESNLEHKKIS 67
>SRRM1_HUMAN (Q8IYB3) Serine/arginine repetitive matrix protein 1| (Ser/Arg-related nuclear matrix protein) (SR-related nuclear matrix protein of 160 kDa) (SRm160) Length = 904 Score = 28.1 bits (61), Expect = 9.0 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = -3 Query: 352 KQREDNREQAEQGRRPRRAAHRSP 281 +++E +RE+ E+ R PRR RSP Sbjct: 157 EEKESSREKRERSRSPRRRKSRSP 180
>ZN469_HUMAN (Q96JG9) Zinc finger protein 469 (Fragment)| Length = 2469 Score = 28.1 bits (61), Expect = 9.0 Identities = 18/53 (33%), Positives = 21/53 (39%) Frame = -3 Query: 376 QGRSCHGHKQREDNREQAEQGRRPRRAAHRSPG*DAFRSR*AVQSRPGNLSCC 218 Q R+C ED A+ R AHR A + AVQ RPG C Sbjct: 124 QRRTCQATVPHEDTFSAADLTRVGESTAHREGAESAVATVEAVQGRPGGTWPC 176
>SRRM1_MOUSE (Q52KI8) Serine/arginine repetitive matrix protein 1| (Plenty-of-prolines 101) Length = 946 Score = 28.1 bits (61), Expect = 9.0 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = -3 Query: 352 KQREDNREQAEQGRRPRRAAHRSP 281 +++E +RE+ E+ R PRR RSP Sbjct: 157 EEKESSREKRERSRSPRRRKSRSP 180
>HLYD_PASHA (P16534) Leukotoxin secretion protein D| Length = 478 Score = 28.1 bits (61), Expect = 9.0 Identities = 15/31 (48%), Positives = 20/31 (64%) Frame = -1 Query: 405 VVVANELANYKDVVVMVTSSGKTTVSRRSKE 313 +VVA LA+ V ++ T+ GK T S RSKE Sbjct: 68 LVVAIVLASVSKVEIVATAPGKLTFSGRSKE 98
>SRRM1_PONPY (Q5R5Q2) Serine/arginine repetitive matrix protein 1| Length = 917 Score = 28.1 bits (61), Expect = 9.0 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = -3 Query: 352 KQREDNREQAEQGRRPRRAAHRSP 281 +++E +RE+ E+ R PRR RSP Sbjct: 157 EEKESSREKRERSRSPRRRKSRSP 180
>CD2L1_MOUSE (P24788) PITSLRE serine/threonine-protein kinase CDC2L1 (EC| 2.7.11.22) (Galactosyltransferase-associated protein kinase p58/GTA) (Cell division cycle 2-like protein kinase 1) Length = 784 Score = 28.1 bits (61), Expect = 9.0 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = -3 Query: 394 ERASELQGRSCHGHKQREDNREQAEQGRRPRRAAHR 287 +R +L+ + K RE +EQ EQ R RRA R Sbjct: 166 DRLEQLERKRERERKLREQQKEQREQKERERRAEER 201 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 55,891,149 Number of Sequences: 219361 Number of extensions: 975664 Number of successful extensions: 2721 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 2640 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2721 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2336739400 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)