| Clone Name | rbags18n09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | POLG_RTSVT (Q91PP5) Genome polyprotein [Contains: Putative leade... | 29 | 2.7 | 2 | NOMO3_HUMAN (P69849) Nodal modulator 3 precursor (pM5 protein 3) | 28 | 4.6 | 3 | NOMO2_HUMAN (Q5JPE7) Nodal modulator 2 precursor (pM5 protein 2) | 28 | 4.6 | 4 | NOMO1_HUMAN (Q15155) Nodal modulator 1 precursor (pM5) | 28 | 7.8 |
|---|
>POLG_RTSVT (Q91PP5) Genome polyprotein [Contains: Putative leader protein;| Coat protein 1 (25 kDa protein) (CP-1); Coat protein 2 (26 kDa protein) (CP-2); Coat protein 3 (35 kDa protein) (CP-3); Putative helicase (EC 3.6.1.-) (Putative NTP-binding protei Length = 3471 Score = 29.3 bits (64), Expect = 2.7 Identities = 18/40 (45%), Positives = 20/40 (50%) Frame = -1 Query: 268 AGPTDAHGAYXFSGYXGEYVVTVNAGNTSKQATFSLSPGD 149 AGPTD H A Y G + V+ G S TFSL P D Sbjct: 665 AGPTDEHNAMLQKIYLGSFKWKVSDGGGSILKTFSL-PSD 703
>NOMO3_HUMAN (P69849) Nodal modulator 3 precursor (pM5 protein 3)| Length = 1222 Score = 28.5 bits (62), Expect = 4.6 Identities = 18/44 (40%), Positives = 21/44 (47%), Gaps = 7/44 (15%) Frame = -1 Query: 259 TDAHGAYXFSGYXGEYVVTV-------NAGNTSKQATFSLSPGD 149 TDAHG++ F G Y V V AG T K TF L+ D Sbjct: 447 TDAHGSFCFKANPGTYKVQVMVPEAETRAGLTLKPQTFPLTVTD 490
>NOMO2_HUMAN (Q5JPE7) Nodal modulator 2 precursor (pM5 protein 2)| Length = 1267 Score = 28.5 bits (62), Expect = 4.6 Identities = 18/44 (40%), Positives = 21/44 (47%), Gaps = 7/44 (15%) Frame = -1 Query: 259 TDAHGAYXFSGYXGEYVVTV-------NAGNTSKQATFSLSPGD 149 TDAHG++ F G Y V V AG T K TF L+ D Sbjct: 447 TDAHGSFCFKAKPGTYKVQVMVPEAETRAGLTLKPQTFPLTVTD 490
>NOMO1_HUMAN (Q15155) Nodal modulator 1 precursor (pM5)| Length = 1222 Score = 27.7 bits (60), Expect = 7.8 Identities = 17/41 (41%), Positives = 20/41 (48%), Gaps = 7/41 (17%) Frame = -1 Query: 259 TDAHGAYXFSGYXGEYVVTV-------NAGNTSKQATFSLS 158 TDAHG++ F G Y V V AG T K TF L+ Sbjct: 447 TDAHGSFCFKAKPGTYKVQVMVPEAETRAGLTLKPQTFPLT 487 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 32,631,794 Number of Sequences: 219361 Number of extensions: 494368 Number of successful extensions: 1363 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1337 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1363 length of database: 80,573,946 effective HSP length: 73 effective length of database: 64,560,593 effective search space used: 1549454232 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)