| Clone Name | rbags19c02 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | B4GT7_HUMAN (Q9UBV7) Beta-1,4-galactosyltransferase 7 (EC 2.4.1.... | 33 | 0.67 | 2 | KPYK_SCHPO (Q10208) Pyruvate kinase (EC 2.7.1.40) (PK) | 30 | 5.7 | 3 | OBSCN_HUMAN (Q5VST9) Obscurin (Obscurin-myosin light chain kinas... | 30 | 7.4 | 4 | SLAF9_MOUSE (Q9D780) SLAM family member 9 precursor | 29 | 9.7 |
|---|
>B4GT7_HUMAN (Q9UBV7) Beta-1,4-galactosyltransferase 7 (EC 2.4.1.-)| (Beta-1,4-GalTase 7) (Beta4Gal-T7) (b4Gal-T7) (UDP-galactose:beta-N-acetylglucosamine beta-1,4-galactosyltransferase 7) (UDP-Gal:beta-GlcNAc beta-1,4-galactosyltransferase 7) [Includes: X Length = 327 Score = 33.1 bits (74), Expect = 0.67 Identities = 20/57 (35%), Positives = 28/57 (49%), Gaps = 3/57 (5%) Frame = +2 Query: 437 SNRQARTLPWPACVAGDGEGTVERR---LHFFSAALRSGIFSMPLSMSGCTSDLARS 598 S R+A LPW +G G + R+ H F A L G FS+ C+ D+AR+ Sbjct: 4 SRRKAAQLPWEDGRSGLLSGGLPRKCSVFHLFVACLSLGFFSLLWLQLSCSGDVARA 60
>KPYK_SCHPO (Q10208) Pyruvate kinase (EC 2.7.1.40) (PK)| Length = 509 Score = 30.0 bits (66), Expect = 5.7 Identities = 25/80 (31%), Positives = 38/80 (47%), Gaps = 3/80 (3%) Frame = -1 Query: 496 PLAIASNASGPRQRPCLPVG*N*KSVI--HTSVVILLEVYVQFCH*IPMYSKYRSLRWFR 323 PLAIA + GP R L VG + H + + Y + C+ MY Y+++ Sbjct: 85 PLAIALDTKGPEIRTGLTVGGTDYPISSGHEMIFTTDDAYAEKCNDKVMYIDYKNI---T 141 Query: 322 SILVTGEVIFV*CGI-SLTV 266 ++ G +I+V GI S TV Sbjct: 142 KVIQPGRIIYVDDGILSFTV 161
>OBSCN_HUMAN (Q5VST9) Obscurin (Obscurin-myosin light chain kinase)| (Obscurin-MLCK) (Obscurin-RhoGEF) Length = 7968 Score = 29.6 bits (65), Expect = 7.4 Identities = 15/36 (41%), Positives = 22/36 (61%) Frame = -1 Query: 595 SCEIRGAAAHRQWHTEDSRP*SSGEEVKSSLDGPLA 488 SC+ R A QW+ +D+ P S E+ K SL+G +A Sbjct: 2489 SCDFRPAPKAVQWYKDDT-PLSPSEKFKMSLEGQMA 2523
>SLAF9_MOUSE (Q9D780) SLAM family member 9 precursor| Length = 285 Score = 29.3 bits (64), Expect = 9.7 Identities = 14/46 (30%), Positives = 19/46 (41%) Frame = -3 Query: 383 CSILSLNTNVLEIQXXXXXXVNTCHWGGYIRVMWHKFDRSPSHLSR 246 CSI +V I NT H G + W D++PS+ R Sbjct: 154 CSIERAGMDVTYIWLSSQDSTNTSHEGSVLSTSWRPGDKAPSYTCR 199 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 84,725,677 Number of Sequences: 219361 Number of extensions: 1652792 Number of successful extensions: 3513 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3418 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3511 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5596027262 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)