| Clone Name | rbaak4m24 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | COAT_TMVER (P03573) Coat protein | 28 | 4.6 | 2 | TOLB_BLOFL (Q7VR84) Protein tolB precursor | 28 | 7.8 | 3 | GCY_ARBPU (P11528) Resact receptor precursor (Guanylate cyclase)... | 28 | 7.8 | 4 | CPC1_NEUCR (P11115) Cross-pathway control protein 1 | 28 | 7.8 | 5 | COAT_TMVRA (Q98747) Coat protein | 28 | 7.8 | 6 | COAT_TMVOM (P03571) Coat protein | 28 | 7.8 | 7 | COAT_TMVO (P69507) Coat protein | 28 | 7.8 | 8 | COAT_TMVKR (P69689) Coat protein | 28 | 7.8 | 9 | COAT_TMVKO (P69508) Coat protein | 28 | 7.8 | 10 | COAT_TMVB (P69688) Coat protein | 28 | 7.8 | 11 | COAT_TMV06 (P03574) Coat protein | 28 | 7.8 | 12 | COAT_TMV (P69687) Coat protein | 28 | 7.8 |
|---|
>COAT_TMVER (P03573) Coat protein| Length = 158 Score = 28.5 bits (62), Expect = 4.6 Identities = 15/47 (31%), Positives = 24/47 (51%), Gaps = 2/47 (4%) Frame = -2 Query: 169 WQEPLEVLNLC--ELGTMVATISYPCLLQRDPNKTRRPDSFLPSDFP 35 W +PLE++NLC LG T ++QR ++ +P + FP Sbjct: 17 WADPLELINLCTNALGNQFQTQQARTVVQRQFSEVWKPSPQVTVRFP 63
>TOLB_BLOFL (Q7VR84) Protein tolB precursor| Length = 460 Score = 27.7 bits (60), Expect = 7.8 Identities = 12/37 (32%), Positives = 18/37 (48%) Frame = -1 Query: 179 YLLVARTVGSTQPL*TGNYGGHNFLSLFTSKRPXQNP 69 Y+L + L T +Y GHN +S+ S P +P Sbjct: 175 YILYTNNIKYAYELCTSDYDGHNQVSICRSSEPLMSP 211
>GCY_ARBPU (P11528) Resact receptor precursor (Guanylate cyclase) (EC 4.6.1.2)| Length = 986 Score = 27.7 bits (60), Expect = 7.8 Identities = 10/24 (41%), Positives = 17/24 (70%) Frame = -2 Query: 181 RICWWQEPLEVLNLCELGTMVATI 110 R CW ++P+E N+ E+ TM+A + Sbjct: 816 RACWVEDPMERPNIIEVRTMLAPL 839
>CPC1_NEUCR (P11115) Cross-pathway control protein 1| Length = 270 Score = 27.7 bits (60), Expect = 7.8 Identities = 16/46 (34%), Positives = 23/46 (50%) Frame = +3 Query: 108 EIVATIVPSSQRLSTSNGSCHQQIRSHLTPAADCPLSLPGHXHQRR 245 E+V ++ P+ Q T + H S TP+ D + PG HQRR Sbjct: 138 ELVQSVQPTVQ--PTVEQTVHSVEASPATPSEDLEVLSPGSGHQRR 181
>COAT_TMVRA (Q98747) Coat protein| Length = 158 Score = 27.7 bits (60), Expect = 7.8 Identities = 14/47 (29%), Positives = 24/47 (51%), Gaps = 2/47 (4%) Frame = -2 Query: 169 WQEPLEVLNLC--ELGTMVATISYPCLLQRDPNKTRRPDSFLPSDFP 35 W +P+E++NLC LG T ++QR ++ +P + FP Sbjct: 17 WADPIELINLCTNALGNQFQTQQARTVVQRQFSEVWKPSPQVTVRFP 63
>COAT_TMVOM (P03571) Coat protein| Length = 158 Score = 27.7 bits (60), Expect = 7.8 Identities = 14/47 (29%), Positives = 24/47 (51%), Gaps = 2/47 (4%) Frame = -2 Query: 169 WQEPLEVLNLC--ELGTMVATISYPCLLQRDPNKTRRPDSFLPSDFP 35 W +P+E++NLC LG T ++QR ++ +P + FP Sbjct: 17 WADPIELINLCTNALGNQFQTQQARTVVQRQFSEVWKPSPQVTVRFP 63
>COAT_TMVO (P69507) Coat protein| Length = 158 Score = 27.7 bits (60), Expect = 7.8 Identities = 14/47 (29%), Positives = 24/47 (51%), Gaps = 2/47 (4%) Frame = -2 Query: 169 WQEPLEVLNLC--ELGTMVATISYPCLLQRDPNKTRRPDSFLPSDFP 35 W +P+E++NLC LG T ++QR ++ +P + FP Sbjct: 17 WADPIELINLCTNALGNQFQTQQARTVVQRQFSEVWKPSPQVTVRFP 63
>COAT_TMVKR (P69689) Coat protein| Length = 158 Score = 27.7 bits (60), Expect = 7.8 Identities = 14/47 (29%), Positives = 24/47 (51%), Gaps = 2/47 (4%) Frame = -2 Query: 169 WQEPLEVLNLC--ELGTMVATISYPCLLQRDPNKTRRPDSFLPSDFP 35 W +P+E++NLC LG T ++QR ++ +P + FP Sbjct: 17 WADPIELINLCTNALGNQFQTQQARTVVQRQFSEVWKPSPQVTVRFP 63
>COAT_TMVKO (P69508) Coat protein| Length = 158 Score = 27.7 bits (60), Expect = 7.8 Identities = 14/47 (29%), Positives = 24/47 (51%), Gaps = 2/47 (4%) Frame = -2 Query: 169 WQEPLEVLNLC--ELGTMVATISYPCLLQRDPNKTRRPDSFLPSDFP 35 W +P+E++NLC LG T ++QR ++ +P + FP Sbjct: 17 WADPIELINLCTNALGNQFQTQQARTVVQRQFSEVWKPSPQVTVRFP 63
>COAT_TMVB (P69688) Coat protein| Length = 158 Score = 27.7 bits (60), Expect = 7.8 Identities = 14/47 (29%), Positives = 24/47 (51%), Gaps = 2/47 (4%) Frame = -2 Query: 169 WQEPLEVLNLC--ELGTMVATISYPCLLQRDPNKTRRPDSFLPSDFP 35 W +P+E++NLC LG T ++QR ++ +P + FP Sbjct: 17 WADPIELINLCTNALGNQFQTQQARTVVQRQFSEVWKPSPQVTVRFP 63
>COAT_TMV06 (P03574) Coat protein| Length = 158 Score = 27.7 bits (60), Expect = 7.8 Identities = 14/47 (29%), Positives = 24/47 (51%), Gaps = 2/47 (4%) Frame = -2 Query: 169 WQEPLEVLNLC--ELGTMVATISYPCLLQRDPNKTRRPDSFLPSDFP 35 W +P+E++NLC LG T ++QR ++ +P + FP Sbjct: 17 WADPIELINLCTNALGNQFQTQQARTVVQRQFSEVWKPSPQVTVRFP 63
>COAT_TMV (P69687) Coat protein| Length = 158 Score = 27.7 bits (60), Expect = 7.8 Identities = 14/47 (29%), Positives = 24/47 (51%), Gaps = 2/47 (4%) Frame = -2 Query: 169 WQEPLEVLNLC--ELGTMVATISYPCLLQRDPNKTRRPDSFLPSDFP 35 W +P+E++NLC LG T ++QR ++ +P + FP Sbjct: 17 WADPIELINLCTNALGNQFQTQQARTVVQRQFSEVWKPSPQVTVRFP 63 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 37,530,802 Number of Sequences: 219361 Number of extensions: 678643 Number of successful extensions: 1731 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 1711 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1731 length of database: 80,573,946 effective HSP length: 72 effective length of database: 64,779,954 effective search space used: 1554718896 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)