| Clone Name | rbags19a23 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | UCHL5_BOVIN (Q9XSJ0) Ubiquitin carboxyl-terminal hydrolase isozy... | 55 | 1e-07 | 2 | UCHL5_MOUSE (Q9WUP7) Ubiquitin carboxyl-terminal hydrolase isozy... | 55 | 1e-07 | 3 | UCHL5_HUMAN (Q9Y5K5) Ubiquitin carboxyl-terminal hydrolase isozy... | 55 | 1e-07 | 4 | UBH4_CAEEL (Q09444) Probable ubiquitin carboxyl-terminal hydrola... | 38 | 0.020 | 5 | SCG1_MOUSE (P16014) Secretogranin-1 precursor (Secretogranin I) ... | 29 | 9.1 |
|---|
>UCHL5_BOVIN (Q9XSJ0) Ubiquitin carboxyl-terminal hydrolase isozyme L5 (EC| 3.4.19.12) (UCH-L5) (Ubiquitin thioesterase L5) (Ubiquitin C-terminal hydrolase UCH37) Length = 328 Score = 55.1 bits (131), Expect = 1e-07 Identities = 24/40 (60%), Positives = 30/40 (75%) Frame = -1 Query: 375 ENIRRKHNYVPFLFNFLKILEEKQQLKPLIEKAKQNSHGR 256 ENIRRKHNY+PF+ LK L E QQL PL+EKAK+ + + Sbjct: 283 ENIRRKHNYLPFIMELLKTLAEHQQLIPLVEKAKEKQNAK 322
>UCHL5_MOUSE (Q9WUP7) Ubiquitin carboxyl-terminal hydrolase isozyme L5 (EC| 3.4.19.12) (UCH-L5) (Ubiquitin thioesterase L5) (Ubiquitin C-terminal hydrolase UCH37) Length = 329 Score = 55.1 bits (131), Expect = 1e-07 Identities = 24/40 (60%), Positives = 30/40 (75%) Frame = -1 Query: 375 ENIRRKHNYVPFLFNFLKILEEKQQLKPLIEKAKQNSHGR 256 ENIRRKHNY+PF+ LK L E QQL PL+EKAK+ + + Sbjct: 284 ENIRRKHNYLPFIMELLKTLAEHQQLIPLVEKAKEKQNAK 323
>UCHL5_HUMAN (Q9Y5K5) Ubiquitin carboxyl-terminal hydrolase isozyme L5 (EC| 3.4.19.12) (UCH-L5) (Ubiquitin thioesterase L5) (Ubiquitin C-terminal hydrolase UCH37) Length = 329 Score = 55.1 bits (131), Expect = 1e-07 Identities = 24/40 (60%), Positives = 30/40 (75%) Frame = -1 Query: 375 ENIRRKHNYVPFLFNFLKILEEKQQLKPLIEKAKQNSHGR 256 ENIRRKHNY+PF+ LK L E QQL PL+EKAK+ + + Sbjct: 284 ENIRRKHNYLPFIMELLKTLAEHQQLIPLVEKAKEKQNAK 323
>UBH4_CAEEL (Q09444) Probable ubiquitin carboxyl-terminal hydrolase ubh-4 (EC| 3.4.19.12) (Ubiquitin C-terminal hydrolase family 1 member 4) (Ubiquitin thioesterase 4) Length = 321 Score = 37.7 bits (86), Expect = 0.020 Identities = 16/35 (45%), Positives = 24/35 (68%) Frame = -1 Query: 375 ENIRRKHNYVPFLFNFLKILEEKQQLKPLIEKAKQ 271 EN RR+HNY PF+ +KIL ++ +L L++ A Q Sbjct: 266 ENNRRRHNYTPFVIELMKILAKEGKLVGLVDNAYQ 300
>SCG1_MOUSE (P16014) Secretogranin-1 precursor (Secretogranin I) (SgI)| (Chromogranin B) (CgB) Length = 677 Score = 28.9 bits (63), Expect = 9.1 Identities = 18/58 (31%), Positives = 26/58 (44%), Gaps = 2/58 (3%) Frame = -3 Query: 418 EDHNGGREGKEVEDGEHQEEAQLRAFLVQFPQDPRGEAATEAPDREGE--TEFSRP*P 251 E+ G EG+E E+GE EE + P+ G + + EG +E RP P Sbjct: 258 EESQEGEEGEEGEEGEEGEEDSASEVTKRRPRHHHGRSGSNKSSYEGHPLSEERRPSP 315 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 60,870,653 Number of Sequences: 219361 Number of extensions: 1019345 Number of successful extensions: 2821 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2730 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2814 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4027872870 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)