| Clone Name | rbags19a16 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SECE_BUCAI (P57152) Preprotein translocase secE subunit | 31 | 4.4 | 2 | GLGA2_ANASP (Q8Z0Q9) Probable glycogen synthase 2 (EC 2.4.1.21) ... | 30 | 5.7 | 3 | GLGA1_ANAVT (Q3M9U1) Glycogen synthase 1 (EC 2.4.1.21) (Starch [... | 30 | 7.5 | 4 | YKY4_CAEEL (Q17963) Hypothetical WD-repeat protein C14B1.4 | 30 | 9.7 |
|---|
>SECE_BUCAI (P57152) Preprotein translocase secE subunit| Length = 127 Score = 30.8 bits (68), Expect = 4.4 Identities = 12/31 (38%), Positives = 20/31 (64%) Frame = +2 Query: 86 YHYRQNKQKVP*SPSWLSFSITPFFLIGDYL 178 +HY +NK K+P W+S SI FF++ ++ Sbjct: 4 HHYNRNKHKIPEKVKWISISI--FFILSFFI 32
>GLGA2_ANASP (Q8Z0Q9) Probable glycogen synthase 2 (EC 2.4.1.21) (Starch| [bacterial glycogen] synthase 2) Length = 492 Score = 30.4 bits (67), Expect = 5.7 Identities = 13/46 (28%), Positives = 28/46 (60%), Gaps = 1/46 (2%) Frame = +1 Query: 175 SCSKPVAAWIGKTDNEK-IAVLHNCFELLLRRGSKLCGVDTTTKGG 309 + KP+ A+IG+ DN+K + ++H+ L +G++ + + T+ G Sbjct: 296 AADKPIIAYIGRLDNQKGVHLVHHAIYHALNKGAQFVLLGSATEAG 341
>GLGA1_ANAVT (Q3M9U1) Glycogen synthase 1 (EC 2.4.1.21) (Starch [bacterial| glycogen] synthase 1) Length = 492 Score = 30.0 bits (66), Expect = 7.5 Identities = 13/46 (28%), Positives = 28/46 (60%), Gaps = 1/46 (2%) Frame = +1 Query: 175 SCSKPVAAWIGKTDNEK-IAVLHNCFELLLRRGSKLCGVDTTTKGG 309 + KP+ A+IG+ DN+K + ++H+ L +G++ + + T+ G Sbjct: 296 AADKPIIAYIGRLDNQKGVHLVHHAIYHSLNKGAQFVLLGSATEAG 341
>YKY4_CAEEL (Q17963) Hypothetical WD-repeat protein C14B1.4| Length = 376 Score = 29.6 bits (65), Expect = 9.7 Identities = 23/85 (27%), Positives = 41/85 (48%), Gaps = 12/85 (14%) Frame = -2 Query: 595 HLNHSITERAVT-----VSSGHVSIDGETVLHQANGKVVKVLDHLDANAYYT-----EFA 446 +++H I ER +T V+ S D V+ ++ K +K+ + + + T + Sbjct: 115 NMDHMICERTLTGHKLGVNDIAWSSDSRCVVSASDDKTLKIFEIVTSRMTKTLKGHNNYV 174 Query: 445 KLLNTKKQSAVV--GSFDEQKRMWN 377 N QS++V GSFDE R+W+ Sbjct: 175 FCCNFNPQSSLVVSGSFDESVRIWD 199 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 105,926,927 Number of Sequences: 219361 Number of extensions: 2160314 Number of successful extensions: 5461 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5279 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5460 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 7366267610 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)