| Clone Name | rbags19a12 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | AES_RAT (P63003) Amino-terminal enhancer of split (Amino enhance... | 30 | 3.3 | 2 | AES_MOUSE (P63002) Amino-terminal enhancer of split (Amino enhan... | 30 | 3.3 | 3 | AES_HUMAN (Q08117) Amino-terminal enhancer of split (Amino enhan... | 30 | 3.3 | 4 | GUN1_PERAE (P05522) Endoglucanase 1 precursor (EC 3.2.1.4) (Endo... | 30 | 4.4 | 5 | SSRP_ANAMM (Q5P9M7) SsrA-binding protein | 28 | 9.7 |
|---|
>AES_RAT (P63003) Amino-terminal enhancer of split (Amino enhancer of split)| (GRG protein) (ESP1 protein) (R-esp1) Length = 197 Score = 30.0 bits (66), Expect = 3.3 Identities = 21/65 (32%), Positives = 33/65 (50%), Gaps = 6/65 (9%) Frame = +3 Query: 171 IVSTLRLLQASVHHRHIGC---ASGPVKHLRIFLDLHEPSFFNYFQVHHS---IKQLNGI 332 I +LLQA H + C AS + R ++ +E S+ ++H +K+LNGI Sbjct: 29 IKDEFQLLQAQYHSLKLECDKLASEKSEMQRHYVMYYEMSYGLNIEMHKQAEIVKRLNGI 88 Query: 333 CASVV 347 CA V+ Sbjct: 89 CAQVL 93
>AES_MOUSE (P63002) Amino-terminal enhancer of split (Amino enhancer of split)| (GRG protein) (ESP1 protein) (Grg-5) Length = 197 Score = 30.0 bits (66), Expect = 3.3 Identities = 21/65 (32%), Positives = 33/65 (50%), Gaps = 6/65 (9%) Frame = +3 Query: 171 IVSTLRLLQASVHHRHIGC---ASGPVKHLRIFLDLHEPSFFNYFQVHHS---IKQLNGI 332 I +LLQA H + C AS + R ++ +E S+ ++H +K+LNGI Sbjct: 29 IKDEFQLLQAQYHSLKLECDKLASEKSEMQRHYVMYYEMSYGLNIEMHKQAEIVKRLNGI 88 Query: 333 CASVV 347 CA V+ Sbjct: 89 CAQVL 93
>AES_HUMAN (Q08117) Amino-terminal enhancer of split (Amino enhancer of split)| (GRG protein) (ESP1 protein) (Gp130-associated protein GAM) Length = 197 Score = 30.0 bits (66), Expect = 3.3 Identities = 21/65 (32%), Positives = 33/65 (50%), Gaps = 6/65 (9%) Frame = +3 Query: 171 IVSTLRLLQASVHHRHIGC---ASGPVKHLRIFLDLHEPSFFNYFQVHHS---IKQLNGI 332 I +LLQA H + C AS + R ++ +E S+ ++H +K+LNGI Sbjct: 29 IKDEFQLLQAQYHSLKLECDKLASEKSEMQRHYVMYYEMSYGLNIEMHKQAEIVKRLNGI 88 Query: 333 CASVV 347 CA V+ Sbjct: 89 CAQVL 93
>GUN1_PERAE (P05522) Endoglucanase 1 precursor (EC 3.2.1.4)| (Endo-1,4-beta-glucanase) (Abscission cellulase 1) Length = 494 Score = 29.6 bits (65), Expect = 4.4 Identities = 19/53 (35%), Positives = 27/53 (50%), Gaps = 1/53 (1%) Frame = -1 Query: 360 DWQLKLQKHRSHSVVLLNGEPGSS*RSWAR-EDLEISSNV*PVQMHNLCADDA 205 D+ LK S+S+ + GEP + R W R ED++ NV V N +D A Sbjct: 124 DYLLKASTATSNSLYVQVGEPNADHRCWERPEDMDTPRNVYKVSTQNPGSDVA 176
>SSRP_ANAMM (Q5P9M7) SsrA-binding protein| Length = 149 Score = 28.5 bits (62), Expect = 9.7 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = +3 Query: 99 IHIKVYNTCHRMNHRVQRVQKLL 167 +HI YN R NH+ RV+KLL Sbjct: 58 LHISEYNRADRKNHKPLRVRKLL 80 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 64,667,733 Number of Sequences: 219361 Number of extensions: 1159073 Number of successful extensions: 2106 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2066 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2106 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3304846491 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)