| Clone Name | rbags19a11 |
|---|---|
| Clone Library Name | barley_pub |
>HHIP_HUMAN (Q96QV1) Hedgehog-interacting protein precursor (HHIP) (HIP)| Length = 700 Score = 30.0 bits (66), Expect = 4.3 Identities = 18/47 (38%), Positives = 26/47 (55%), Gaps = 3/47 (6%) Frame = +3 Query: 324 MQPATT*GTVCPRISRNGFVSASG---CSIGSS*TIWFNTSACFPAC 455 +QPA T + C R+ RNG+ + +G CS G + T+ C PAC Sbjct: 598 VQPAQTLTSECSRLCRNGYCTPTGKCCCSPGWE-GDFCRTAKCEPAC 643
>SCN5A_HUMAN (Q14524) Sodium channel protein type 5 alpha subunit (Sodium channel| protein type V alpha subunit) (Voltage-gated sodium channel alpha subunit Nav1.5) (Sodium channel protein, cardiac muscle alpha-subunit) (HH1) Length = 2016 Score = 30.0 bits (66), Expect = 4.3 Identities = 18/55 (32%), Positives = 27/55 (49%), Gaps = 3/55 (5%) Frame = -2 Query: 505 SVILACVVMHDAF---GVRLHAGKQAEVLNQIVYELPIEHPLAETKPLREILGHT 350 +V+L C++ F GV L AGK +NQ +LP+ + + K E L T Sbjct: 1336 NVLLVCLIFWLIFSIMGVNLFAGKFGRCINQTEGDLPLNYTIVNNKSQCESLNLT 1390
>O10K2_HUMAN (Q6IF99) Olfactory receptor 10K2 (Olfactory receptor OR1-4)| Length = 312 Score = 29.6 bits (65), Expect = 5.6 Identities = 20/82 (24%), Positives = 39/82 (47%), Gaps = 8/82 (9%) Frame = -2 Query: 439 AEVLNQIVYELP------IEHPLAETKPLREILGHT--VPQVVAGCILGILTAVIMLLVL 284 A+++ +V+ LP + H + P+ ++ H Q+V + ++ A+ +LL+L Sbjct: 156 AQIITSLVFHLPFYSSNQLHHFFCDIAPVLKLASHHNHFSQIVIFMLCTLVLAIPLLLIL 215 Query: 283 GSYI*ISAIFDHLISYRRSCKA 218 SY+ I + S CKA Sbjct: 216 VSYVHILSAILQFPSTLGRCKA 237
>LSPA_TREPA (O83943) Lipoprotein signal peptidase (EC 3.4.23.36)| (Prolipoprotein signal peptidase) (Signal peptidase II) (SPase II) Length = 197 Score = 29.3 bits (64), Expect = 7.4 Identities = 12/29 (41%), Positives = 20/29 (68%) Frame = -2 Query: 361 LGHTVPQVVAGCILGILTAVIMLLVLGSY 275 +GH + QV+ +LGI+ +IM L++ SY Sbjct: 74 IGHQLNQVLRTLVLGIVPLIIMFLIVFSY 102
>RBGPR_RAT (Q5U1Z0) Rab3 GTPase-activating protein non-catalytic subunit (Rab3| GTPase-activating protein 150 kDa subunit) (Rab3-GAP p150) (Rab3-GAP regulatory subunit) (RAB3-GAP150) Length = 1386 Score = 29.3 bits (64), Expect = 7.4 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = +1 Query: 451 RATEHQKHRASPHMQVSLKLQMWH 522 R+ EH +H +PH+Q + L MW+ Sbjct: 1034 RSIEHLRHILNPHVQNGISLMMWN 1057
>SCN5A_RAT (P15389) Sodium channel protein type 5 alpha subunit (Sodium channel| protein type V alpha subunit) (Voltage-gated sodium channel alpha subunit Nav1.5) (Sodium channel protein, cardiac muscle alpha-subunit) Length = 2019 Score = 28.9 bits (63), Expect = 9.6 Identities = 15/46 (32%), Positives = 24/46 (52%), Gaps = 3/46 (6%) Frame = -2 Query: 505 SVILACVVMHDAF---GVRLHAGKQAEVLNQIVYELPIEHPLAETK 377 +V+L C++ F GV L AGK +NQ +LP+ + + K Sbjct: 1338 NVLLVCLIFWLIFSIMGVNLFAGKFGRCINQTEGDLPLNYTIVNNK 1383
>DBP10_CANGA (Q6FNA2) ATP-dependent RNA helicase DBP10 (EC 3.6.1.-)| Length = 969 Score = 28.9 bits (63), Expect = 9.6 Identities = 13/46 (28%), Positives = 26/46 (56%) Frame = +2 Query: 71 PTANISDLQHQLKLRPTILQRRSKSVKTL*QQHGQATFTHYIQDEL 208 P +++L H+ + +QR++K K L ++ A TH ++DE+ Sbjct: 670 PEDEMANLMHRRRRAIAPIQRKAKERKELLEKERMAGLTHALEDEI 715
>LSHR_CHICK (Q90674) Lutropin-choriogonadotropic hormone receptor (LH/CG-R)| (LSH-R) (Luteinizing hormone receptor) (Fragment) Length = 366 Score = 28.9 bits (63), Expect = 9.6 Identities = 14/33 (42%), Positives = 21/33 (63%) Frame = -2 Query: 361 LGHTVPQVVAGCILGILTAVIMLLVLGSYI*IS 263 L H VP ++ G + IL AV+ LL + SY+ +S Sbjct: 143 LRHAVPIMLGGWVFSILIAVLPLLGVSSYMKVS 175 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 75,681,072 Number of Sequences: 219361 Number of extensions: 1508836 Number of successful extensions: 4122 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 3941 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4121 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4258037034 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)