| Clone Name | rbags18k01 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | AXL1_YEAST (P40851) Putative protease AXL1 (EC 3.4.99.-) | 33 | 0.63 | 2 | KCY_MYCMS (Q6MTJ7) Cytidylate kinase (EC 2.7.4.14) (CK) (Cytidin... | 33 | 1.1 | 3 | GPR1_RAT (P46090) Probable G-protein coupled receptor 1 | 30 | 7.0 | 4 | HYPA_CLOPE (Q46205) Protein hypA | 30 | 7.0 | 5 | MUT7_CAEEL (P34607) Probable exonuclease mut-7 (EC 3.1.-.-) | 30 | 9.1 |
|---|
>AXL1_YEAST (P40851) Putative protease AXL1 (EC 3.4.99.-)| Length = 1208 Score = 33.5 bits (75), Expect = 0.63 Identities = 27/97 (27%), Positives = 50/97 (51%), Gaps = 2/97 (2%) Frame = -3 Query: 607 SLLKPDQLAEVIDTFKLKISEDRLMSRCTKCNGIFIQKPLTLDEAMEASKGFQVIPSCLF 428 + LK L +++ +F + SED M C+K +GI +Q L KGF+ + + Sbjct: 425 TFLKEQNLIDLV-SFLYQSSEDLPMEECSKLSGI-LQDDLECLTPPNIFKGFKSLIE-ID 481 Query: 427 NRNMEFWKCTDCNQLYWEG--TQYHNAVQKFMSVCNI 323 + N+E ++ T N +W G ++ N ++ FM+ N+ Sbjct: 482 DPNIEKYENTKANIQWWTGQAIKFQNFLKSFMNHDNM 518
>KCY_MYCMS (Q6MTJ7) Cytidylate kinase (EC 2.7.4.14) (CK) (Cytidine| monophosphate kinase) (CMP kinase) Length = 222 Score = 32.7 bits (73), Expect = 1.1 Identities = 19/89 (21%), Positives = 42/89 (47%), Gaps = 9/89 (10%) Frame = -3 Query: 679 ILLTRDAKLIKYQYLATNQVYRVKS---------LLKPDQLAEVIDTFKLKISEDRLMSR 527 ++ + A+++ YQ++ T +YR + + DQ+ +++D+F KIS++++ Sbjct: 18 VIFKKVARILNYQFVDTGLMYRAFTWYCLFKNIDINNQDQIIKLLDSFDYKISDEQIF-- 75 Query: 526 CTKCNGIFIQKPLTLDEAMEASKGFQVIP 440 N I + L E + +IP Sbjct: 76 ---VNNINVTNKLISSEILNVINKITIIP 101
>GPR1_RAT (P46090) Probable G-protein coupled receptor 1| Length = 353 Score = 30.0 bits (66), Expect = 7.0 Identities = 14/32 (43%), Positives = 19/32 (59%) Frame = -3 Query: 262 HHKATWQAFLFGWRCNPLLLFSDVHVLMLFCT 167 HH TW FLFG+ PLL S ++ ++F T Sbjct: 201 HHVLTWVKFLFGYLL-PLLTMSSCYLCLIFKT 231
>HYPA_CLOPE (Q46205) Protein hypA| Length = 973 Score = 30.0 bits (66), Expect = 7.0 Identities = 15/26 (57%), Positives = 19/26 (73%) Frame = +3 Query: 12 DRDLSECIQGDIIERAVSYYMLNFTY 89 D+ +S I+GDI AVSYY+ NFTY Sbjct: 893 DQPISNGIKGDI---AVSYYLSNFTY 915
>MUT7_CAEEL (P34607) Probable exonuclease mut-7 (EC 3.1.-.-)| Length = 910 Score = 29.6 bits (65), Expect = 9.1 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = -3 Query: 592 DQLAEVIDTFKLKISEDRLMSRCTKCN 512 DQL E D F + I + + RCT+CN Sbjct: 746 DQLIEFFDLFNVDIRPEDVYPRCTECN 772 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 100,232,154 Number of Sequences: 219361 Number of extensions: 2096288 Number of successful extensions: 4833 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 4675 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4830 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6882837918 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)