| Clone Name | rbags18i07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | VF12_VARV (P33871) Protein F12 | 31 | 2.5 | 2 | PDLI5_RAT (Q62920) PDZ and LIM domain protein 5 (Enigma homolog)... | 30 | 4.3 | 3 | TTLL4_MOUSE (Q80UG8) Tubulin--tyrosine ligase-like protein 4 | 29 | 7.3 | 4 | CS029_MOUSE (Q9CS00) Protein C19orf29 homolog | 29 | 7.3 | 5 | PGCA_CANFA (Q28343) Aggrecan core protein precursor (Cartilage-s... | 29 | 9.5 | 6 | NCKX1_RAT (Q9QZM6) Sodium/potassium/calcium exchanger 1 (Na(+)/K... | 29 | 9.5 |
|---|
>VF12_VARV (P33871) Protein F12| Length = 635 Score = 30.8 bits (68), Expect = 2.5 Identities = 21/63 (33%), Positives = 32/63 (50%) Frame = +1 Query: 76 MPAKKKLV*KGHLVSSHSHSLDFSYLCTPTVSIYTSSRVRGPEPPSVLMMPRRRGNTSVP 255 +P K + + L + S SLD +++ T TVS+Y + GP P + P GNT V Sbjct: 197 LPFDIKYISRDELWAQISSSLDQTHIKTITVSVYGAITDNGPMPYMISTYP---GNTFVN 253 Query: 256 WRS 264 + S Sbjct: 254 FNS 256
>PDLI5_RAT (Q62920) PDZ and LIM domain protein 5 (Enigma homolog) (Enigma-like| PDZ and LIM domains protein) Length = 591 Score = 30.0 bits (66), Expect = 4.3 Identities = 16/42 (38%), Positives = 22/42 (52%) Frame = -3 Query: 339 WRRPRCWTTAPSTVRSRNAEAASHTRSPRHGRVSPPPRHHED 214 W+RP APST R N+ ++S T +P V PP +D Sbjct: 358 WQRPN--QAAPSTGRISNSASSSGTGAPMKPAVGPPQPSDQD 397
>TTLL4_MOUSE (Q80UG8) Tubulin--tyrosine ligase-like protein 4| Length = 1193 Score = 29.3 bits (64), Expect = 7.3 Identities = 15/37 (40%), Positives = 18/37 (48%) Frame = +1 Query: 109 HLVSSHSHSLDFSYLCTPTVSIYTSSRVRGPEPPSVL 219 HL++SH H L+ S C V R P PPS L Sbjct: 417 HLLASHVHGLNPSPACGSAVDPQVLGEDRAPVPPSSL 453
>CS029_MOUSE (Q9CS00) Protein C19orf29 homolog| Length = 772 Score = 29.3 bits (64), Expect = 7.3 Identities = 19/47 (40%), Positives = 26/47 (55%), Gaps = 1/47 (2%) Frame = -3 Query: 345 GKWRRPRCWTTAPSTVRSRN-AEAASHTRSPRHGRVSPPPRHHEDRR 208 G+ +R R + S RSR+ + + S +RS HGR S R HE RR Sbjct: 23 GRKQRSRSRGRSRSRSRSRSRSRSRSRSRSRSHGRSSRRRREHERRR 69
>PGCA_CANFA (Q28343) Aggrecan core protein precursor (Cartilage-specific| proteoglycan core protein) (CSPCP) Length = 2333 Score = 28.9 bits (63), Expect = 9.5 Identities = 15/36 (41%), Positives = 20/36 (55%) Frame = -3 Query: 345 GKWRRPRCWTTAPSTVRSRNAEAASHTRSPRHGRVS 238 G W +PR T PST + R + +S R+PR R S Sbjct: 2297 GHWEKPRITCTDPSTYKRRLQKRSS--RAPRRSRPS 2330
>NCKX1_RAT (Q9QZM6) Sodium/potassium/calcium exchanger 1| (Na(+)/K(+)/Ca(2+)-exchange protein 1) (Retinal rod Na-Ca+K exchanger) Length = 1181 Score = 28.9 bits (63), Expect = 9.5 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = -3 Query: 273 SHTRSPRHGRVSPPPRHHEDRRWLGTPDPRG 181 S+T PR GR S P H + + TP P G Sbjct: 165 SYTPKPRGGRKSSSPTHTREEGRMHTPSPAG 195 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 65,682,735 Number of Sequences: 219361 Number of extensions: 1295315 Number of successful extensions: 3640 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 3487 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3636 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4200495993 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)