| Clone Name | rbags18h14 |
|---|---|
| Clone Library Name | barley_pub |
>YNK6_YEAST (P50942) Hypothetical 133.3 kDa protein in CYB5-LEU4 intergenic| region Length = 1183 Score = 30.0 bits (66), Expect = 1.6 Identities = 20/73 (27%), Positives = 32/73 (43%) Frame = +3 Query: 33 SXQGHAAKQNIXSSTHLKDHNGTTAAHNIVHNRPNRPCHEAIKIRSPGTLSLSIDRCYNI 212 S H+++ ++ SS+ + + N P PCHE K+ S G+ S D Sbjct: 135 SISTHSSRSSLRSSS--------SRSLNAQEQAPKHPCHELRKLLSNGSFYYSTDFDLTC 186 Query: 213 XLDSAFKQGFSSH 251 L K+GF+ H Sbjct: 187 TLQ---KRGFTEH 196
>STCK_EMENI (Q00706) Putative sterigmatocystin biosynthesis fatty acid synthase| beta subunit Length = 1914 Score = 30.0 bits (66), Expect = 1.6 Identities = 18/57 (31%), Positives = 28/57 (49%), Gaps = 6/57 (10%) Frame = -3 Query: 209 VVAPVDREREGSWTPDFDRLMA---RSIWSIMHYVMSSCCPIV---ILQMCTGXYVL 57 ++ +R R SW P FD L+ R I H+ M+ C +V +L+ TG V+ Sbjct: 1479 IIGDNERTRFCSWAPSFDGLVRANDRLRMEIQHFAMADGCMVVHVRVLKESTGEQVM 1535
>SRK3_SPOLA (P42689) Tyrosine-protein kinase SRK3 (EC 2.7.10.2) (Fragment)| Length = 334 Score = 28.5 bits (62), Expect = 4.5 Identities = 24/61 (39%), Positives = 25/61 (40%), Gaps = 6/61 (9%) Frame = +3 Query: 129 RPNRPCHEAIKIRSPGTLSLS------IDRCYNIXLDSAFKQGFSSHVWKTQWGGLTXVA 290 R +RPC A P T LS IDR I L QG VW W G T VA Sbjct: 37 RLSRPCSRA---NIPITSGLSYKDEWEIDRT-TIQLQRKLGQGNFGEVWAGVWNGTTAVA 92 Query: 291 V 293 V Sbjct: 93 V 93
>ATS12_HUMAN (P58397) ADAMTS-12 precursor (EC 3.4.24.-) (A disintegrin and| metalloproteinase with thrombospondin motifs 12) (ADAM-TS 12) (ADAM-TS12) Length = 1593 Score = 27.7 bits (60), Expect = 7.8 Identities = 13/34 (38%), Positives = 18/34 (52%) Frame = -3 Query: 278 EPSPLGLPDMR*EPLFEGAVEANVVAPVDREREG 177 +P P+ PD R E +G E +VV PV + G Sbjct: 31 QPGPVRFPDRRQEHFIKGLPEYHVVGPVRVDASG 64
>ATG4_YARLI (Q6CH28) Probable cysteine protease ATG4 (EC 3.4.22.-)| (Autophagy-related protein 4) Length = 545 Score = 27.7 bits (60), Expect = 7.8 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = -3 Query: 218 EANVVAPVDREREGSWTPDFDRLMARSIW 132 E +V P+D + SW PDF + IW Sbjct: 46 EDGIVVPLDTSNDTSWPPDFLADVQSRIW 74 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 42,246,378 Number of Sequences: 219361 Number of extensions: 731031 Number of successful extensions: 1716 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1702 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1716 length of database: 80,573,946 effective HSP length: 74 effective length of database: 64,341,232 effective search space used: 1544189568 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)