| Clone Name | rbags18g23 |
|---|---|
| Clone Library Name | barley_pub |
>BAK1_ARATH (Q94F62) BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1| precursor (EC 2.7.11.1) (BRI1-associated receptor kinase 1) (Somatic embryogenesis receptor-like kinase 3) Length = 615 Score = 42.7 bits (99), Expect = 0.001 Identities = 20/48 (41%), Positives = 29/48 (60%) Frame = -2 Query: 671 DELVDARLGKDFNPNEIARMIACAAACVRHSARRRPRMSQVVRALEGD 528 + LVD L ++ E+ ++I A C + S RP+MS+VVR LEGD Sbjct: 519 EALVDVDLQGNYKDEEVEQLIQVALLCTQSSPMERPKMSEVVRMLEGD 566
>SIRK_ARATH (O64483) Senescence-induced receptor-like serine/threonine-protein| kinase precursor (FLG22-induced receptor-like kinase 1) Length = 876 Score = 35.4 bits (80), Expect = 0.16 Identities = 17/44 (38%), Positives = 26/44 (59%) Frame = -2 Query: 665 LVDARLGKDFNPNEIARMIACAAACVRHSARRRPRMSQVVRALE 534 +VD RL + ++ +M A AC H++ +RP MSQVV L+ Sbjct: 800 IVDQRLRERYDVGSAWKMSEIALACTEHTSAQRPTMSQVVMELK 843
>HM37_CAEEL (Q93356) Homeobox protein ceh-37| Length = 278 Score = 30.4 bits (67), Expect = 5.2 Identities = 20/85 (23%), Positives = 38/85 (44%), Gaps = 2/85 (2%) Frame = -2 Query: 569 RPRMSQVVRALEGDVSLEDLN--EGVRPGHSRXXXXXXXXXXXXGQYNEDMKKFKKMAFT 396 +P++ + + +G V+ L + + P + Q+N D K + F Sbjct: 138 QPQIKSELESCDGAVASGKLGTPKSISPVETTASTTSSNTSAAELQWNGD---HKILGFG 194 Query: 395 TNDYTSSQYSAPTSEYGQIPSASSS 321 N+ T+S +PT++ PS+SSS Sbjct: 195 KNETTTSAAVSPTADNASTPSSSSS 219
>SIX4_HUMAN (Q9UIU6) Homeobox protein SIX4 (Sine oculis homeobox homolog 4)| Length = 760 Score = 29.6 bits (65), Expect = 8.8 Identities = 19/52 (36%), Positives = 28/52 (53%), Gaps = 3/52 (5%) Frame = -2 Query: 434 NEDMKKFKKMAFTTNDYTSSQY--SAPTSEYGQIPSAS-SSEGQQTQEIETG 288 ++D+K+FK + + N T++ Y S P S G IPS EG QT + G Sbjct: 394 SQDVKEFKVLQSSANSATTTSYSPSVPVSFPGLIPSTEVKREGIQTVASQDG 445
>IRAK1_MOUSE (Q62406) Interleukin-1 receptor-associated kinase 1 (EC 2.7.11.1)| (IRAK-1) (IRAK) (Pelle-like protein kinase) (mPLK) Length = 710 Score = 29.6 bits (65), Expect = 8.8 Identities = 18/49 (36%), Positives = 28/49 (57%), Gaps = 1/49 (2%) Frame = -2 Query: 674 YDELVDARLGKDFNPNEIARMIACAAACVRHS-ARRRPRMSQVVRALEG 531 Y + +D+R G P ++ +A A C H A++RP M+QV + LEG Sbjct: 474 YKKHLDSRPGPC--PPQLGLALAQLACCCMHRRAKKRPPMTQVYKRLEG 520
>SRK6_BRAOE (Q09092) Putative serine/threonine-protein kinase receptor| precursor (EC 2.7.11.1) (S-receptor kinase) (SRK) Length = 849 Score = 29.6 bits (65), Expect = 8.8 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = -2 Query: 638 FNPNEIARMIACAAACVRHSARRRPRMSQVV 546 F P E+ + I CV+ A RP MS VV Sbjct: 773 FQPQEVLKCIQIGLLCVQELAEHRPAMSSVV 803 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 85,887,026 Number of Sequences: 219361 Number of extensions: 1614405 Number of successful extensions: 4261 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 4135 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4260 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6655306086 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)