| Clone Name | rbags18f24 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | BPA1_HUMAN (Q03001) Bullous pemphigoid antigen 1 isoforms 1/2/3/... | 30 | 3.9 | 2 | CR015_HUMAN (Q96N68) Protein C18orf15 | 30 | 6.6 | 3 | K0323_HUMAN (O15037) Protein KIAA0323 | 30 | 6.6 | 4 | HTPX_BIFLO (Q8G6T7) Probable protease htpX homolog (EC 3.4.24.-) | 30 | 6.6 |
|---|
>BPA1_HUMAN (Q03001) Bullous pemphigoid antigen 1 isoforms 1/2/3/4/5/8 (230 kDa| bullous pemphigoid antigen) (BPA) (Hemidesmosomal plaque protein) (Dystonia musculorum protein) (Dystonin) (Fragment) Length = 3214 Score = 30.4 bits (67), Expect = 3.9 Identities = 12/26 (46%), Positives = 19/26 (73%) Frame = +1 Query: 232 PFCLEPATSSSSCRGMSGLQRQHNSQ 309 P C P T ++SCR ++GLQ++H+ Q Sbjct: 1901 PVC--PITQATSCRAVTGLQQEHDKQ 1924
>CR015_HUMAN (Q96N68) Protein C18orf15| Length = 181 Score = 29.6 bits (65), Expect = 6.6 Identities = 16/48 (33%), Positives = 23/48 (47%) Frame = -1 Query: 166 VHPRPLVLWILCWFQVVDVHLLLVCFYLLMCVI*VCSIFLCXRSVESF 23 VHP+ L + +C V VH + C Y+ MCV+ C R+ F Sbjct: 119 VHPQSLTVVCMCACMCVCVH-VCACVYVCMCVLVCMCACACMRAHRYF 165
>K0323_HUMAN (O15037) Protein KIAA0323| Length = 678 Score = 29.6 bits (65), Expect = 6.6 Identities = 27/84 (32%), Positives = 32/84 (38%), Gaps = 10/84 (11%) Frame = +1 Query: 229 GPFCL--EPATSSSSC------RGMSGLQRQHNSQLEPYR--HYPK*SCRPWHFAYLLRS 378 G FC+ EP + SC RG S LQR HN P R P PWH R Sbjct: 317 GGFCVHREPPGAHGSCHRAAQSRGASLLQRLHNGNASPPRVPSPPPAPEPPWHCGD--RG 374 Query: 379 SCSTHSRRSDQQCRTSALHRQRVP 450 C D+ + + R R P Sbjct: 375 DCGDRGDVGDRGDKQQGMARGRGP 398
>HTPX_BIFLO (Q8G6T7) Probable protease htpX homolog (EC 3.4.24.-)| Length = 306 Score = 29.6 bits (65), Expect = 6.6 Identities = 17/51 (33%), Positives = 26/51 (50%), Gaps = 3/51 (5%) Frame = +2 Query: 344 VGHGILHTYSEALVARIHDVLINNVARRRSTGSGYLGHS---DGAHQRDQR 487 +GH ++H Y+ HD+L + +A +T YLG+S G RD R Sbjct: 133 LGHELMHVYN-------HDILTSAIASAMATVISYLGYSLMYFGGGSRDDR 176 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 76,091,459 Number of Sequences: 219361 Number of extensions: 1486119 Number of successful extensions: 3722 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3624 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3721 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4986986160 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)