| Clone Name | rbags18e01 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | FAS1_YARLI (P34229) Fatty acid synthase beta subunit (EC 2.3.1.8... | 32 | 1.7 | 2 | YEHL_ECOLI (P33348) Hypothetical protein yehL | 30 | 3.9 | 3 | TOXC_COCCA (Q92215) Putative fatty acid synthase subunit TOXC [I... | 30 | 5.0 |
|---|
>FAS1_YARLI (P34229) Fatty acid synthase beta subunit (EC 2.3.1.86) [Includes:| 3-hydroxypalmitoyl-[acyl-carrier-protein] dehydratase (EC 4.2.1.61); Enoyl-[acyl-carrier-protein] reductase [NADH] (EC 1.3.1.9); [Acyl-carrier-protein] acetyltransferase (EC 2. Length = 2086 Score = 31.6 bits (70), Expect = 1.7 Identities = 15/45 (33%), Positives = 26/45 (57%), Gaps = 3/45 (6%) Frame = +1 Query: 157 LVRILLPSAI---LFQLLHLSNEVPHDPGADSASIGDPIPASPSV 282 +++ + P AI + +L+HLSN PGAD +GD + A+ + Sbjct: 1360 IIKAIFPRAIDADILRLVHLSNGFKMMPGADPLQMGDVVSATAKI 1404
>YEHL_ECOLI (P33348) Hypothetical protein yehL| Length = 362 Score = 30.4 bits (67), Expect = 3.9 Identities = 18/51 (35%), Positives = 25/51 (49%), Gaps = 1/51 (1%) Frame = -1 Query: 541 FSWGYA*ISQHGSVQEALFTAPLSSRWGNQPGLILSCASL-YLPYSLQDCM 392 + W YA + HG EAL APL G + G I+ + P +QDC+ Sbjct: 121 YGWNYALLINHGPSTEALVPAPLYQ--GMRDGKIVRFEEITRTPLEVQDCL 169
>TOXC_COCCA (Q92215) Putative fatty acid synthase subunit TOXC [Includes:| 3-hydroxypalmitoyl-[acyl-carrier-protein] dehydratase (EC 4.2.1.61); Enoyl-[acyl-carrier-protein] reductase [NADH] (EC 1.3.1.9); [Acyl-carrier-protein] acetyltransferase (EC 2.3.1.3 Length = 2080 Score = 30.0 bits (66), Expect = 5.0 Identities = 13/26 (50%), Positives = 17/26 (65%) Frame = +1 Query: 187 LFQLLHLSNEVPHDPGADSASIGDPI 264 L QL+HLSNE PGA+ IG+ + Sbjct: 1360 LLQLVHLSNEFRMTPGAEPLKIGEEV 1385 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 98,264,378 Number of Sequences: 219361 Number of extensions: 2194377 Number of successful extensions: 6256 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5219 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6235 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4986986160 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)