| Clone Name | rbags18d23 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CR1KA_BACTM (Q45715) Pesticidal crystal protein cry1Ka (Insectic... | 30 | 4.6 | 2 | CTNA_DROME (P35220) Alpha-catenin | 30 | 6.0 | 3 | PAQR3_HUMAN (Q6TCH7) Progestin and adipoQ receptor family member... | 30 | 7.9 |
|---|
>CR1KA_BACTM (Q45715) Pesticidal crystal protein cry1Ka (Insecticidal| delta-endotoxin CryIK(a)) (Crystaline entomocidal protoxin) (137 kDa crystal protein) Length = 1215 Score = 30.4 bits (67), Expect = 4.6 Identities = 18/60 (30%), Positives = 27/60 (45%), Gaps = 4/60 (6%) Frame = -1 Query: 481 LTGKCLAKIKAGNFDKQQKTWKFQ----NTITEALEDITALHYDEVRDEIYTGNRHGLVH 314 L GK L+++K + K K Q TEA E + AL D D++ G++H Sbjct: 900 LLGKALSRVKRAEKKWRDKYEKLQLETKRVYTEAKESVDALFVDSQYDKLQANTNIGIIH 959
>CTNA_DROME (P35220) Alpha-catenin| Length = 917 Score = 30.0 bits (66), Expect = 6.0 Identities = 15/44 (34%), Positives = 27/44 (61%), Gaps = 1/44 (2%) Frame = -1 Query: 499 INISNILTGKCLAKIKAGNFDKQQKTWKFQ-NTITEALEDITAL 371 IN ++ILT + +K+ N ++ W+ Q +TEA++DIT + Sbjct: 468 INAASILTVRPNSKVAQENMTTYRQAWEVQVRILTEAVDDITTI 511
>PAQR3_HUMAN (Q6TCH7) Progestin and adipoQ receptor family member 3 (Progestin| and adipoQ receptor family member III) Length = 311 Score = 29.6 bits (65), Expect = 7.9 Identities = 12/38 (31%), Positives = 22/38 (57%) Frame = -3 Query: 260 CSFAGGPI*QPSLRWCWPRRGLGSPAVSNLLMWIVVLF 147 CS +G + P+L W W G+G+P V + ++V++ Sbjct: 208 CSVSGYGV-IPTLHWVWLNGGIGAPIVQDFAPRVIVMY 244 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 91,256,136 Number of Sequences: 219361 Number of extensions: 1889134 Number of successful extensions: 4769 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4621 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4767 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 5972710590 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)