| Clone Name | rbags18d15 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PHOSP_NDVB (P24698) Phosphoprotein (Protein P) | 30 | 5.7 | 2 | TFB3_SCHPO (O94684) RNA polymerase II transcription factor B sub... | 30 | 9.7 | 3 | BGLS_HANAN (P06835) Beta-glucosidase precursor (EC 3.2.1.21) (Ge... | 30 | 9.7 |
|---|
>PHOSP_NDVB (P24698) Phosphoprotein (Protein P)| Length = 395 Score = 30.4 bits (67), Expect = 5.7 Identities = 14/29 (48%), Positives = 17/29 (58%) Frame = +2 Query: 164 TNPTKMLLLLLPKFSEKSMKAQAGQWSPP 250 T + LLL+L K S KS A+ G WS P Sbjct: 111 TGASNSLLLMLDKLSNKSSNAKKGLWSSP 139
>TFB3_SCHPO (O94684) RNA polymerase II transcription factor B subunit 3 (RNA| polymerase II transcription factor B p38 subunit) (RNA polymerase II transcription factor B 38 kDa subunit) (CDK-activating kinase assembly factor MAT1 homolog) (RING finger prot Length = 318 Score = 29.6 bits (65), Expect = 9.7 Identities = 20/70 (28%), Positives = 30/70 (42%), Gaps = 2/70 (2%) Frame = +3 Query: 138 RLLLPDYQQPIQPKCYSYFCQNSRKRA*KHRQGSGPLPTDNQTMNDD--RRLTWRSRITE 311 R L P+ + I P+CY C++ R P P N+ + R T+ E Sbjct: 20 RYLNPNMKLLINPECYHKMCESCVDRIFTTGPAQCPTPGCNKILRKAKFREQTFEDAQIE 79 Query: 312 RHPSVRRRLS 341 R VR+R+S Sbjct: 80 REVDVRKRIS 89
>BGLS_HANAN (P06835) Beta-glucosidase precursor (EC 3.2.1.21) (Gentiobiase)| (Cellobiase) (Beta-D-glucoside glucohydrolase) Length = 825 Score = 29.6 bits (65), Expect = 9.7 Identities = 11/42 (26%), Positives = 22/42 (52%) Frame = -1 Query: 521 GNVSSKSWSSLLNRNADLLEEESVAELVHKLDGLSRPGSPCN 396 G ++ W + R +L+++ S+AE V+ G+ PC+ Sbjct: 46 GRINDGKWQAAFYRARELVDQMSIAEKVNLTTGVGSASGPCS 87 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 105,134,459 Number of Sequences: 219361 Number of extensions: 2264717 Number of successful extensions: 7048 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6676 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7045 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 7366267610 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)