ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbags18d05 |
|---|---|
| Clone Library Name | barley_pub |
>GLH2_CAEEL (Q966L9) ATP-dependent RNA helicase glh-2 (EC 3.6.1.-) (Germline| helicase 2) Length = 974 Score = 34.3 bits (77), Expect = 0.38 Identities = 10/16 (62%), Positives = 14/16 (87%) Frame = -1 Query: 488 CFTCGQSGHRASDCPN 441 CF CG+ GHR+++CPN Sbjct: 475 CFNCGEQGHRSNECPN 490 Score = 31.2 bits (69), Expect = 3.2 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = -1 Query: 488 CFTCGQSGHRASDCP 444 CF C Q GHR++DCP Sbjct: 373 CFNCQQPGHRSNDCP 387 Score = 31.2 bits (69), Expect = 3.2 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = -1 Query: 488 CFTCGQSGHRASDCP 444 CF C Q GHR++DCP Sbjct: 259 CFNCQQPGHRSNDCP 273
>GLH1_CAEEL (P34689) ATP-dependent RNA helicase glh-1 (EC 3.6.1.-) (Germline| helicase 1) Length = 763 Score = 34.3 bits (77), Expect = 0.38 Identities = 10/16 (62%), Positives = 14/16 (87%) Frame = -1 Query: 488 CFTCGQSGHRASDCPN 441 CF CG+ GHR+++CPN Sbjct: 264 CFNCGEQGHRSNECPN 279 Score = 32.3 bits (72), Expect = 1.4 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -1 Query: 488 CFTCGQSGHRASDCP 444 CF C Q GHR+SDCP Sbjct: 160 CFNCQQPGHRSSDCP 174
>GAG_JSRV (P31622) Gag polyprotein [Contains: Core protein p10; Core protein| p18; Core protein p12; Core protein p27; Core protein p14; Core protein p4] Length = 612 Score = 33.9 bits (76), Expect = 0.49 Identities = 12/17 (70%), Positives = 13/17 (76%) Frame = -1 Query: 488 CFTCGQSGHRASDCPNK 438 CF CGQ GHRA+ CP K Sbjct: 509 CFVCGQPGHRAAVCPQK 525
>HEXP_LEIMA (Q04832) DNA-binding protein HEXBP (Hexamer-binding protein)| Length = 271 Score = 32.7 bits (73), Expect = 1.1 Identities = 10/16 (62%), Positives = 13/16 (81%) Frame = -1 Query: 488 CFTCGQSGHRASDCPN 441 CF CG++GH + DCPN Sbjct: 72 CFRCGEAGHMSRDCPN 87 Score = 31.2 bits (69), Expect = 3.2 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = -1 Query: 488 CFTCGQSGHRASDCPNK 438 CF CG+ GH + +CPN+ Sbjct: 45 CFRCGEEGHMSRECPNE 61 Score = 30.0 bits (66), Expect = 7.1 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = -1 Query: 488 CFTCGQSGHRASDCPN 441 C+ CG +GH + DCPN Sbjct: 170 CYKCGDAGHISRDCPN 185 Score = 30.0 bits (66), Expect = 7.1 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = -1 Query: 488 CFTCGQSGHRASDCPN 441 C+ CG +GH + DCPN Sbjct: 142 CYKCGDAGHISRDCPN 157 Score = 30.0 bits (66), Expect = 7.1 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = -1 Query: 488 CFTCGQSGHRASDCPN 441 C+ CGQ GH + DCP+ Sbjct: 99 CYKCGQEGHLSRDCPS 114
>CNBP_CHICK (O42395) Cellular nucleic acid-binding protein (CNBP) (Zinc finger| protein 9) Length = 172 Score = 32.3 bits (72), Expect = 1.4 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = -1 Query: 491 ACFTCGQSGHRASDCPNK*TAHTKCC 414 AC+ CG+ GH A DC +CC Sbjct: 68 ACYNCGRGGHIAKDCKEPKREREQCC 93
>LMO6_MOUSE (Q80VL3) LIM domain only protein 6 (Triple LIM domain protein 6)| Length = 624 Score = 32.3 bits (72), Expect = 1.4 Identities = 13/23 (56%), Positives = 14/23 (60%) Frame = +2 Query: 560 HQRRRICHRRMTSHHAHHRTSGH 628 H+RRR HRR SHH HH H Sbjct: 516 HRRRRQRHRRRGSHHHHHHPGRH 538
>CNBP_RAT (P62634) Cellular nucleic acid-binding protein (CNBP) (Zinc finger| protein 9) Length = 177 Score = 32.3 bits (72), Expect = 1.4 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = -1 Query: 491 ACFTCGQSGHRASDCPNK*TAHTKCC 414 AC+ CG+ GH A DC +CC Sbjct: 73 ACYNCGRGGHIAKDCKEPKREREQCC 98 Score = 30.0 bits (66), Expect = 7.1 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = -1 Query: 488 CFTCGQSGHRASDCP 444 CF CG+SGH A +CP Sbjct: 6 CFKCGRSGHWARECP 20
>CNBP_PONPY (Q5R5R5) Cellular nucleic acid-binding protein (CNBP) (Zinc finger| protein 9) Length = 177 Score = 32.3 bits (72), Expect = 1.4 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = -1 Query: 491 ACFTCGQSGHRASDCPNK*TAHTKCC 414 AC+ CG+ GH A DC +CC Sbjct: 73 ACYNCGRGGHIAKDCKEPKREREQCC 98 Score = 30.0 bits (66), Expect = 7.1 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = -1 Query: 488 CFTCGQSGHRASDCP 444 CF CG+SGH A +CP Sbjct: 6 CFKCGRSGHWARECP 20
>CNBP_MOUSE (P53996) Cellular nucleic acid-binding protein (CNBP) (Zinc finger| protein 9) Length = 178 Score = 32.3 bits (72), Expect = 1.4 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = -1 Query: 491 ACFTCGQSGHRASDCPNK*TAHTKCC 414 AC+ CG+ GH A DC +CC Sbjct: 74 ACYNCGRGGHIAKDCKEPKREREQCC 99 Score = 30.0 bits (66), Expect = 7.1 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = -1 Query: 488 CFTCGQSGHRASDCP 444 CF CG+SGH A +CP Sbjct: 6 CFKCGRSGHWARECP 20
>CNBP_HUMAN (P62633) Cellular nucleic acid-binding protein (CNBP) (Zinc finger| protein 9) Length = 177 Score = 32.3 bits (72), Expect = 1.4 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = -1 Query: 491 ACFTCGQSGHRASDCPNK*TAHTKCC 414 AC+ CG+ GH A DC +CC Sbjct: 73 ACYNCGRGGHIAKDCKEPKREREQCC 98 Score = 30.0 bits (66), Expect = 7.1 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = -1 Query: 488 CFTCGQSGHRASDCP 444 CF CG+SGH A +CP Sbjct: 6 CFKCGRSGHWARECP 20
>GIS2_YEAST (P53849) Zinc-finger protein GIS2| Length = 153 Score = 32.0 bits (71), Expect = 1.9 Identities = 10/16 (62%), Positives = 13/16 (81%) Frame = -1 Query: 488 CFTCGQSGHRASDCPN 441 C+TCGQ+GH + DC N Sbjct: 118 CYTCGQAGHMSRDCQN 133
>ZN324_HUMAN (O75467) Zinc finger protein 324 (Zinc finger protein ZF5128)| Length = 553 Score = 30.8 bits (68), Expect = 4.2 Identities = 19/50 (38%), Positives = 27/50 (54%), Gaps = 2/50 (4%) Frame = +1 Query: 292 ADHRSTHKGGRPCDVPWRCVQLCPAACRK--LMRPERSSAAGKQHFVCAV 435 + HR H GGR P+ C Q CR L++ ER+ G++ FVCA+ Sbjct: 357 SQHRKIHAGGR----PYACAQCGRRFCRNSHLIQHERTH-TGEKPFVCAL 401
>NAS3_HORVU (Q9ZQV8) Probable nicotianamine synthase 3 (EC 2.5.1.43)| (S-adenosyl-L-methionine:S-adenosyl-L-methionine:S- adenosyl-methionine 3-amino-3-carboxypropyltransferase 3) (HvNAS3) Length = 335 Score = 30.4 bits (67), Expect = 5.4 Identities = 16/58 (27%), Positives = 29/58 (50%), Gaps = 1/58 (1%) Frame = +2 Query: 44 TGXHVVVAVVNILSPTP-TSGKPKKIKTSNVPVKPLDITRIIQRKARLSFGVSAACQK 214 TG H +A + LSP+P ++ T+ VP P+D+T++ + G+ C + Sbjct: 18 TGLHAAIAKLPSLSPSPDVDALFTELVTACVPPSPVDVTKLGPEAQEMREGLIRLCSE 75
>NAS2_HORVU (Q9ZQV7) Probable nicotianamine synthase 2 (EC 2.5.1.43)| (S-adenosyl-L-methionine:S-adenosyl-L-methionine:S- adenosyl-methionine 3-amino-3-carboxypropyltransferase 2) (HvNAS2) Length = 335 Score = 30.4 bits (67), Expect = 5.4 Identities = 16/58 (27%), Positives = 29/58 (50%), Gaps = 1/58 (1%) Frame = +2 Query: 44 TGXHVVVAVVNILSPTP-TSGKPKKIKTSNVPVKPLDITRIIQRKARLSFGVSAACQK 214 TG H +A + LSP+P ++ T+ VP P+D+T++ + G+ C + Sbjct: 17 TGLHAAIAKLPSLSPSPDVDALFTELVTACVPPSPVDVTKLGPEAQEMREGLIRLCSE 74
>MUA3_CAEEL (P34576) Transmembrane cell adhesion receptor mua-3 precursor| (Muscle attachment abnormal protein 3) Length = 3767 Score = 30.4 bits (67), Expect = 5.4 Identities = 16/41 (39%), Positives = 21/41 (51%) Frame = -3 Query: 408 CRAAPFGPHQLPTSGWTKLNTTPRNIARPASLVCRSVICIC 286 CR P GP SG+ ++ R RPA VCR+V+ C Sbjct: 729 CRETPIGPMCQCVSGYVDVS---RQHGRPAGRVCRAVVNEC 766
>NAS7_HORVU (Q9ZWH8) Probable nicotianamine synthase 7 (EC 2.5.1.43)| (S-adenosyl-L-methionine:S-adenosyl-L-methionine:S- adenosyl-methionine 3-amino-3-carboxypropyltransferase 7) (HvNAS7) Length = 329 Score = 30.4 bits (67), Expect = 5.4 Identities = 16/58 (27%), Positives = 28/58 (48%), Gaps = 1/58 (1%) Frame = +2 Query: 44 TGXHVVVAVVNILSPTP-TSGKPKKIKTSNVPVKPLDITRIIQRKARLSFGVSAACQK 214 TG H +A + LSP+P + T+ VP P+D+T++ + G+ C + Sbjct: 16 TGLHAAIAKLPSLSPSPDVDALFTDLVTACVPPSPVDVTKLAPEAQAMREGLIRLCSE 73
>NAS4_HORVU (Q9ZQV6) Probable nicotianamine synthase 4 (EC 2.5.1.43)| (S-adenosyl-L-methionine:S-adenosyl-L-methionine:S- adenosyl-methionine 3-amino-3-carboxypropyltransferase 4) (HvNAS4) Length = 329 Score = 30.4 bits (67), Expect = 5.4 Identities = 16/58 (27%), Positives = 28/58 (48%), Gaps = 1/58 (1%) Frame = +2 Query: 44 TGXHVVVAVVNILSPTP-TSGKPKKIKTSNVPVKPLDITRIIQRKARLSFGVSAACQK 214 TG H +A + LSP+P + T+ VP P+D+T++ + G+ C + Sbjct: 16 TGLHAAIAKLPSLSPSPDVDALFTDLVTACVPPSPVDVTKLAPEAQAMREGLIRLCSE 73
>RSPO3_BRARE (Q5R328) R-spondin-3 precursor (Roof plate-specific spondin-3)| (Cabriolet) Length = 317 Score = 30.0 bits (66), Expect = 7.1 Identities = 16/49 (32%), Positives = 20/49 (40%) Frame = +1 Query: 325 PCDVPWRCVQLCPAACRKLMRPERSSAAGKQHFVCAVYLFGQSDALCPD 471 P D CV CPA C + + HF+ A GQ +CPD Sbjct: 135 PSDTKKECVAACPALCDLCQNSDTCTRCVPGHFLHA----GQCHHVCPD 179
>ZCH14_MOUSE (Q8VIG0) Zinc finger CCHC domain-containing protein 14 (BDG-29)| Length = 956 Score = 30.0 bits (66), Expect = 7.1 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = -1 Query: 491 ACFTCGQSGHRASDC 447 +C+ CG +GHRA DC Sbjct: 914 SCYNCGATGHRAQDC 928
>POL_COYMV (P19199) Putative polyprotein [Contains: Coat protein; Protease (EC| 3.4.23.-); Reverse transcriptase (EC 2.7.7.49); Ribonuclease H (EC 3.1.26.4)] Length = 1886 Score = 30.0 bits (66), Expect = 7.1 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -1 Query: 488 CFTCGQSGHRASDCPNK 438 C+ CGQ GH A+ C NK Sbjct: 881 CYICGQEGHYANQCRNK 897
>ZCH14_HUMAN (Q8WYQ9) Zinc finger CCHC domain-containing protein 14 (BDG-29)| Length = 949 Score = 30.0 bits (66), Expect = 7.1 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = -1 Query: 491 ACFTCGQSGHRASDC 447 +C+ CG +GHRA DC Sbjct: 907 SCYNCGATGHRAQDC 921
>NAS6_HORVU (Q9ZQV3) Probable nicotianamine synthase 6 (EC 2.5.1.43)| (S-adenosyl-L-methionine:S-adenosyl-L-methionine:S- adenosyl-methionine 3-amino-3-carboxypropyltransferase 6) (HvNAS6) Length = 328 Score = 30.0 bits (66), Expect = 7.1 Identities = 16/58 (27%), Positives = 28/58 (48%), Gaps = 1/58 (1%) Frame = +2 Query: 44 TGXHVVVAVVNILSPTP-TSGKPKKIKTSNVPVKPLDITRIIQRKARLSFGVSAACQK 214 TG H +A + LSP+P + T+ VP P+D+T++ + G+ C + Sbjct: 16 TGLHAAIAKLPSLSPSPDVDALFTDLVTACVPPSPVDVTKLGSEAQEMREGLIRLCSE 73
>NAS8_HORVU (Q9XFB6) Nicotianamine synthase 8 (EC 2.5.1.43)| (S-adenosyl-L-methionine:S-adenosyl-L-methionine:S- adenosyl-methionine 3-amino-3-carboxypropyltransferase 8) Length = 329 Score = 30.0 bits (66), Expect = 7.1 Identities = 16/58 (27%), Positives = 28/58 (48%), Gaps = 1/58 (1%) Frame = +2 Query: 44 TGXHVVVAVVNILSPTP-TSGKPKKIKTSNVPVKPLDITRIIQRKARLSFGVSAACQK 214 TG H +A + LSP+P + T+ VP P+D+T++ + G+ C + Sbjct: 16 TGLHAAIAKLPSLSPSPDVDALFTDLVTACVPPSPVDVTKLGSEAQEMREGLIRLCSE 73
>GAG_SIVG1 (Q02843) Gag polyprotein [Contains: Core protein p17; Core protein| p24; Core protein p15] Length = 513 Score = 29.6 bits (65), Expect = 9.3 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = -1 Query: 488 CFTCGQSGHRASDCPN 441 CF CG+ GH A DC N Sbjct: 413 CFKCGKIGHMAKDCKN 428
>MUC5B_HUMAN (Q9HC84) Mucin-5B precursor (Mucin 5 subtype B, tracheobronchial)| (High molecular weight salivary mucin MG1) (Sublingual gland mucin) Length = 5703 Score = 29.6 bits (65), Expect = 9.3 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = +1 Query: 310 HKGGRPCDVPWRCVQLCPAAC 372 H GG+P + WRC +LCP C Sbjct: 311 HAGGQPRN--WRCPELCPRTC 329 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 88,383,849 Number of Sequences: 219361 Number of extensions: 1723797 Number of successful extensions: 6022 Number of sequences better than 10.0: 25 Number of HSP's better than 10.0 without gapping: 5526 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5996 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 7026286028 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
