| Clone Name | rbags18c10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | RDH12_HUMAN (Q96NR8) Retinol dehydrogenase 12 (EC 1.1.1.-) (All-... | 27 | 0.92 | 2 | CASC5_HUMAN (Q8NG31) Protein CASC5 (Cancer susceptibility candid... | 30 | 6.6 |
|---|
>RDH12_HUMAN (Q96NR8) Retinol dehydrogenase 12 (EC 1.1.1.-) (All-trans and 9-cis| retinol dehydrogenase) Length = 316 Score = 27.3 bits (59), Expect(2) = 0.92 Identities = 23/70 (32%), Positives = 31/70 (44%), Gaps = 4/70 (5%) Frame = -1 Query: 626 GTNDRSKFLRSQLALQLLKNSFGLKVVNVERILKSVTSINV----KEKECSFFMLYVHIV 459 G N FL + L L+ LK S +VVNV + + I EK S Y H Sbjct: 145 GVNHLGHFLLTYLLLEQLKVSAPARVVNVSSVAHHIGKIPFHDLQSEKRYSRGFAYCHSK 204 Query: 458 LMDNLLFSSD 429 L N+LF+ + Sbjct: 205 LA-NVLFTRE 213 Score = 24.3 bits (51), Expect(2) = 0.92 Identities = 21/66 (31%), Positives = 28/66 (42%) Frame = -3 Query: 441 LLERRFQKQDRDNRRLAQFSTELFDPDRMHGLEVLRFQGPKQGVVSPARCNAEKACRQW* 262 LL R F + R AQ S + + L F K+ VSP N + A R W Sbjct: 246 LLWRLFSPFVKTAREGAQTSLHCALAEGLEPLSGKYFSDCKRTWVSPRARNNKTAERLWN 305 Query: 261 HSCQLI 244 SC+L+ Sbjct: 306 VSCELL 311
>CASC5_HUMAN (Q8NG31) Protein CASC5 (Cancer susceptibility candidate gene 5| protein) (ALL1-fused gene from chromosome 15q14) (AF15q14) (D40/AF15q14 protein) Length = 2342 Score = 30.0 bits (66), Expect = 6.6 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = +1 Query: 106 TWAENTVSHHQLPKMRLQFTLTHHLCQ 186 +W + + HQLPKM +F+L H C+ Sbjct: 2211 SWKKTCTTQHQLPKMLEEFSLVVHHCR 2237 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 89,793,505 Number of Sequences: 219361 Number of extensions: 1751477 Number of successful extensions: 4455 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4331 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4454 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6541540170 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)