| Clone Name | rbags17m06 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | DMD_CAEEL (Q9TW65) Dystrophin-1 | 33 | 0.98 | 2 | FOG2_MOUSE (Q8CCH7) Zinc finger protein ZFPM2 (Zinc finger prote... | 31 | 2.8 | 3 | FOG2_HUMAN (Q8WW38) Zinc finger protein ZFPM2 (Zinc finger prote... | 31 | 3.7 | 4 | MYCD_RAT (Q8R5I7) Myocardin | 30 | 6.3 | 5 | TECTB_CHICK (P54097) Beta-tectorin precursor | 30 | 8.3 |
|---|
>DMD_CAEEL (Q9TW65) Dystrophin-1| Length = 3674 Score = 32.7 bits (73), Expect = 0.98 Identities = 14/32 (43%), Positives = 17/32 (53%) Frame = -2 Query: 240 FPVFGRTKRAMTCYYCDLLQNSFTVFNCWKHH 145 FP+ G R +TC+ CDL QN F K H Sbjct: 3312 FPIIGIRYRCLTCFNCDLCQNCFFSQRTAKSH 3343
>FOG2_MOUSE (Q8CCH7) Zinc finger protein ZFPM2 (Zinc finger protein multitype| 2) (Friend of GATA protein 2) (Friend of GATA-2) (FOG-2) (mFOG-2) Length = 1151 Score = 31.2 bits (69), Expect = 2.8 Identities = 18/56 (32%), Positives = 26/56 (46%), Gaps = 9/56 (16%) Frame = +3 Query: 237 GMENDFSPVDH------HSAKTNIPGPQRDSSLSSS---ELHLNKHSGPSQKSFTP 377 G + + +PV H + P PQ S S++ E+HLN HSG + F P Sbjct: 275 GRQREAAPVSEENEDNSHQVSSLCPFPQCTKSFSNARALEMHLNSHSGVKMEEFLP 330
>FOG2_HUMAN (Q8WW38) Zinc finger protein ZFPM2 (Zinc finger protein multitype| 2) (Friend of GATA protein 2) (FOG-2) (hFOG-2) Length = 1151 Score = 30.8 bits (68), Expect = 3.7 Identities = 18/56 (32%), Positives = 26/56 (46%), Gaps = 9/56 (16%) Frame = +3 Query: 237 GMENDFSPVDH------HSAKTNIPGPQRDSSLSSS---ELHLNKHSGPSQKSFTP 377 G + + +PV H + P PQ S S++ E+HLN HSG + F P Sbjct: 275 GRQREAAPVSEENEDSAHQISSLCPFPQCTKSFSNARALEMHLNSHSGVKMEEFLP 330
>MYCD_RAT (Q8R5I7) Myocardin| Length = 938 Score = 30.0 bits (66), Expect = 6.3 Identities = 16/52 (30%), Positives = 25/52 (48%) Frame = +1 Query: 16 QNKRFSFPSNHHGNIQNHYSRLLRNNTSLSTIQN*ALNFPFTSVVLPAIKNS 171 Q +RFS+P H +++ ++ RN S ST P + L +KNS Sbjct: 321 QQQRFSYPGMHQAHLKEPNEQMTRNPNSSST--------PLNNTPLSPVKNS 364
>TECTB_CHICK (P54097) Beta-tectorin precursor| Length = 329 Score = 29.6 bits (65), Expect = 8.3 Identities = 21/66 (31%), Positives = 29/66 (43%), Gaps = 7/66 (10%) Frame = +3 Query: 210 WPFLSSQRRGMENDFSPVDHHSAKTNIPGPQRDS-------SLSSSELHLNKHSGPSQKS 368 WP ++ +G +DFS V H + KTN Q ++ LS LH H S+K Sbjct: 218 WPLIT---KGCASDFSIVVHENGKTNRATFQFNAFRFQNIPKLSKVWLHCETHVCDSEKF 274 Query: 369 FTPTDC 386 P C Sbjct: 275 SCPVTC 280 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 99,537,247 Number of Sequences: 219361 Number of extensions: 2026258 Number of successful extensions: 5193 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5040 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5192 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6257125380 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)