| Clone Name | rbags17m04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | HPS5_MOUSE (P59438) Hermansky-Pudlak syndrome 5 protein homolog ... | 32 | 2.4 | 2 | RTP1_TRYBG (P15593) Retrotransposable element SLACS 45 kDa prote... | 31 | 4.1 | 3 | BGS1_SCHPO (Q10287) 1,3-beta-glucan synthase component bgs1 (EC ... | 31 | 4.1 |
|---|
>HPS5_MOUSE (P59438) Hermansky-Pudlak syndrome 5 protein homolog (Ruby-eye| protein 2) (Ru2) Length = 1126 Score = 31.6 bits (70), Expect = 2.4 Identities = 16/49 (32%), Positives = 23/49 (46%) Frame = +2 Query: 380 YISKKALQRSLLWTAPICLPSNVSTNLQL*AGHHMFDGSRSLYPQVFGC 526 Y +LQR L +CL NV T+ G H+ S+ L P++ C Sbjct: 725 YAITNSLQRDLAELTTLCLELNVLTSAMESVGGHVDRASQQLSPEILAC 773
>RTP1_TRYBG (P15593) Retrotransposable element SLACS 45 kDa protein (ORF1)| Length = 404 Score = 30.8 bits (68), Expect = 4.1 Identities = 11/31 (35%), Positives = 17/31 (54%), Gaps = 4/31 (12%) Frame = -3 Query: 394 FLRYVY----W*PTCFSGDQTRHCPECGWTH 314 ++R+++ W TCF HCP CG+ H Sbjct: 277 YIRFLHVRQSWWSTCFKAHMEFHCPVCGFAH 307
>BGS1_SCHPO (Q10287) 1,3-beta-glucan synthase component bgs1 (EC 2.4.1.34)| (1,3-beta-D-glucan-UDP glucosyltransferase) Length = 1729 Score = 30.8 bits (68), Expect = 4.1 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = +3 Query: 159 RFARSSLVYKLRIYYLLYIQAIFSWFPVYIY 251 RF+ SL + R+ Y+L +I +W P YIY Sbjct: 1322 RFSGPSLYFGSRLMYMLLFGSITAWLPHYIY 1352 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 101,350,302 Number of Sequences: 219361 Number of extensions: 2160077 Number of successful extensions: 4462 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4319 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4462 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 6912958834 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)