| Clone Name | rbags17i23 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | RPOD_AGRT5 (P33452) RNA polymerase sigma factor rpoD (Sigma-A) (... | 31 | 4.1 | 2 | UVRC_HELHP (Q7VK73) UvrABC system protein C (Protein uvrC) (Exci... | 31 | 4.1 | 3 | VP40_VZVD (P09286) Capsid protein P40 (Virion structural gene 33... | 30 | 9.1 |
|---|
>RPOD_AGRT5 (P33452) RNA polymerase sigma factor rpoD (Sigma-A) (Major| vegetative sigma factor) Length = 684 Score = 30.8 bits (68), Expect = 4.1 Identities = 14/48 (29%), Positives = 28/48 (58%) Frame = -3 Query: 608 TGSLQKGVRDKIISLANRYMTEVRRLNLPQNQTDNVYRGFRDLEEKLL 465 TG+L G + L ++ +T V+ L+L QN+ D++ D+ ++L+ Sbjct: 305 TGTLSSGQERRYKELKDQLITAVKSLSLNQNRIDSLVEQLYDISKRLM 352
>UVRC_HELHP (Q7VK73) UvrABC system protein C (Protein uvrC) (Excinuclease ABC| subunit C) Length = 621 Score = 30.8 bits (68), Expect = 4.1 Identities = 18/66 (27%), Positives = 31/66 (46%) Frame = -3 Query: 596 QKGVRDKIISLANRYMTEVRRLNLPQNQTDNVYRGFRDLEEKLLSPY*PFFFLSSQHCKA 417 Q+G + ++ LA++ E+RRL+ QN T + ++L PY F +S H Sbjct: 371 QRGAKKDLLQLAHKNALEIRRLHTQQNNTFSTLVSIKELCVLSQIPYSIEVFDTSHHSGT 430 Query: 416 KTSSGV 399 G+ Sbjct: 431 HNVGGM 436
>VP40_VZVD (P09286) Capsid protein P40 (Virion structural gene 33 protein)| [Contains: Capsid protein VP24 (Assemblin) (Protease) (EC 3.4.21.97); Capsid protein VP22A; C-terminal peptide] Length = 605 Score = 29.6 bits (65), Expect = 9.1 Identities = 17/55 (30%), Positives = 28/55 (50%) Frame = +2 Query: 401 HLKMSWLYSVERTKKRMANKEITISPLGHGNLGTHYLFGSVGDSIASPLSYTCSP 565 +L ++L SV + KR++ EI GN TH VG + + ++Y C+P Sbjct: 110 YLVTNYLPSVSLSSKRLSPNEIP-----DGNFFTHVALCVVGRRVGTVVNYDCTP 159 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 99,433,669 Number of Sequences: 219361 Number of extensions: 2056468 Number of successful extensions: 4661 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4534 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4661 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6882837918 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)