| Clone Name | rbags16p23 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | T103_MOUSE (Q9CRD2) Tetratricopeptide repeat protein KIAA0103 | 44 | 4e-04 | 2 | T103_HUMAN (Q15006) Tetratricopeptide repeat protein KIAA0103 | 44 | 4e-04 |
|---|
>T103_MOUSE (Q9CRD2) Tetratricopeptide repeat protein KIAA0103| Length = 297 Score = 43.9 bits (102), Expect = 4e-04 Identities = 22/53 (41%), Positives = 35/53 (66%) Frame = -2 Query: 491 KVLYTLGGLENLQTAKKYYASTIQLTGGKNTRALFGVCLCSAAISQLTKGRNK 333 +V YT GGLENL+ ++KY+A ++L +N RALFG+ + ++ I+ K K Sbjct: 197 EVKYTQGGLENLELSRKYFAQALKL-NNRNMRALFGLYMSASHIASNPKASAK 248
>T103_HUMAN (Q15006) Tetratricopeptide repeat protein KIAA0103| Length = 297 Score = 43.9 bits (102), Expect = 4e-04 Identities = 22/53 (41%), Positives = 35/53 (66%) Frame = -2 Query: 491 KVLYTLGGLENLQTAKKYYASTIQLTGGKNTRALFGVCLCSAAISQLTKGRNK 333 +V YT GGLENL+ ++KY+A ++L +N RALFG+ + ++ I+ K K Sbjct: 197 EVKYTQGGLENLELSRKYFAQALKL-NNRNMRALFGLYMSASHIASNPKASAK 248 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 79,760,793 Number of Sequences: 219361 Number of extensions: 1426664 Number of successful extensions: 3404 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3332 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3403 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6029593548 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)