| Clone Name | rbags17e03 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | NU6M_EQUAS (P92486) NADH-ubiquinone oxidoreductase chain 6 (EC 1... | 32 | 2.3 | 2 | PLD2_HUMAN (O14939) Phospholipase D2 (EC 3.1.4.4) (PLD 2) (Choli... | 31 | 3.0 | 3 | K1199_HUMAN (Q8WUJ3) Protein KIAA1199 precursor | 30 | 6.7 | 4 | NU6M_HORSE (P48657) NADH-ubiquinone oxidoreductase chain 6 (EC 1... | 30 | 6.7 |
|---|
>NU6M_EQUAS (P92486) NADH-ubiquinone oxidoreductase chain 6 (EC 1.6.5.3) (NADH| dehydrogenase subunit 6) Length = 175 Score = 31.6 bits (70), Expect = 2.3 Identities = 27/97 (27%), Positives = 49/97 (50%), Gaps = 5/97 (5%) Frame = -1 Query: 674 PVATSLLVPASSVKGSGI--SFGGS-LQLLGFCTFESCVGIFWPSIMKMRSQYIPEE--A 510 P+ L++ S G GI +FGGS L L+ F + + + + M ++ PE + Sbjct: 26 PIYGGLVLIVSGGVGCGIIMNFGGSFLGLMVFLIYLGGMLVVFGYTTAMATEQYPEVWVS 85 Query: 509 RSTIMNFFRIPLNLFVCVVLYNVNAFPITVMFGMCSI 399 +T+M F + L + V +VLY + + + V+F S+ Sbjct: 86 NATVMGVFLLGLLMEVMLVLYVLKSEEVGVVFKFSSV 122
>PLD2_HUMAN (O14939) Phospholipase D2 (EC 3.1.4.4) (PLD 2) (Choline phosphatase| 2) (Phosphatidylcholine-hydrolyzing phospholipase D2) (PLD1C) (hPLD2) Length = 933 Score = 31.2 bits (69), Expect = 3.0 Identities = 16/53 (30%), Positives = 31/53 (58%), Gaps = 3/53 (5%) Frame = +3 Query: 405 THAKHDGDRESIH---IVEHHTHKQVQWYAEEVHDGAPCLLRDILRSHLHDRW 554 T A+H ++ H I++ +++Q +W+A+E+ + A RD L+ H HD + Sbjct: 274 TEARHGVRIDTSHRSLILKCSSYRQARWWAQEITELAQGPGRDFLQLHRHDSY 326
>K1199_HUMAN (Q8WUJ3) Protein KIAA1199 precursor| Length = 1361 Score = 30.0 bits (66), Expect = 6.7 Identities = 9/31 (29%), Positives = 19/31 (61%) Frame = -3 Query: 468 VCVCGALQCECFPYHRHVWHVFNLPLHGGNL 376 + V G ++ +C+PY H+ + F+ GG++ Sbjct: 498 IIVMGEMEDKCYPYRNHICNFFDFDTFGGHI 528
>NU6M_HORSE (P48657) NADH-ubiquinone oxidoreductase chain 6 (EC 1.6.5.3) (NADH| dehydrogenase subunit 6) Length = 175 Score = 30.0 bits (66), Expect = 6.7 Identities = 26/92 (28%), Positives = 47/92 (51%), Gaps = 5/92 (5%) Frame = -1 Query: 674 PVATSLLVPASSVKGSGI--SFGGS-LQLLGFCTFESCVGIFWPSIMKMRSQYIPEE--A 510 P+ L++ S G GI +FGGS L L+ F + + + + M ++ PE + Sbjct: 26 PIYGGLVLIVSGGVGCGIIMNFGGSFLGLMVFLIYLGGMLVVFGYTTAMATEQYPEVWVS 85 Query: 509 RSTIMNFFRIPLNLFVCVVLYNVNAFPITVMF 414 +T+M F + L + V +VLY + + + V+F Sbjct: 86 NTTVMGVFLLGLLMEVMLVLYVLKSEEVGVVF 117 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 105,141,449 Number of Sequences: 219361 Number of extensions: 2312039 Number of successful extensions: 5282 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5089 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5280 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6655306086 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)