>IF3A_ARATH (Q9LD55) Eukaryotic translation initiation factor 3 subunit 10 (eIF-3|
            theta) (Eukaryotic translation initiation factor 3 large
            subunit) (eIF3a) (p114)
          Length = 987

 Score = 30.4 bits (67), Expect = 2.3
 Identities = 21/71 (29%), Positives = 34/71 (47%), Gaps = 2/71 (2%)
 Frame = +3

Query: 159  KLETLMRREKENV*AGANQQPQRSPEPPSFTI--TKRPAFVSSSSCTACTRMPK*FFKST 332
            +LE   RRE+E +  G N  P R  EP    +  T   A  +++   A   +PK   ++T
Sbjct: 846  ELEEKSRREREELLRGTNAPPARLAEPTVTPVGTTAPAAAAAAAGAPAAPYVPKWKRQTT 905

Query: 333  NMPSPSLLSSA 365
             +  PS  +S+
Sbjct: 906  EVSGPSAPTSS 916

>CS015_MACFA (Q4R6B2) Protein C19orf15 homolog precursor|
          Length = 1159

 Score = 29.3 bits (64), Expect = 5.0
 Identities = 11/15 (73%), Positives = 13/15 (86%)
 Frame = +1

Query: 64   CNY*LTFLLFLHGVP 108
            CNY LTFLL +HG+P
Sbjct: 1046 CNYQLTFLLHIHGLP 1060

>CS015_HUMAN (Q6ZRH7) Protein C19orf15 precursor|
          Length = 1159

 Score = 29.3 bits (64), Expect = 5.0
 Identities = 11/15 (73%), Positives = 13/15 (86%)
 Frame = +1

Query: 64   CNY*LTFLLFLHGVP 108
            CNY LTFLL +HG+P
Sbjct: 1046 CNYQLTFLLHIHGLP 1060


  Database: uniprot_sprot.fasta
    Posted date:  May 25, 2006  5:36 PM
  Number of letters in database: 80,573,946
  Number of sequences in database:  219,361
  
Lambda     K      H
   0.318    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 53,047,950
Number of Sequences: 219361
Number of extensions: 899615
Number of successful extensions: 2159
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 2114
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2159
length of database: 80,573,946
effective HSP length: 102
effective length of database: 58,199,124
effective search space used: 2909956200
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)