| Clone Name | rbags16o05 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CU030_HUMAN (Q9UFM2) Putative protein C21orf30 | 30 | 2.0 | 2 | META_THEMA (Q9WZY3) Homoserine O-succinyltransferase (EC 2.3.1.4... | 28 | 7.4 | 3 | RAI1_HUMAN (Q7Z5J4) Retinoic acid-induced protein 1 | 27 | 9.7 | 4 | BYR4_SCHPO (Q10951) Protein byr4 | 27 | 9.7 |
|---|
>CU030_HUMAN (Q9UFM2) Putative protein C21orf30| Length = 244 Score = 29.6 bits (65), Expect = 2.0 Identities = 21/57 (36%), Positives = 29/57 (50%), Gaps = 3/57 (5%) Frame = +3 Query: 135 QPTRGTACXML-RKIIDMLALQQRNRVRKP--AHLVHSSLQXGEVSDWFQHKQGWRS 296 Q +RGTA L ++ LAL + + +P +HLV S L D K+GWRS Sbjct: 54 QRSRGTALPFLPSNVLPSLALPSTSFLCRPLLSHLVTSLLAGPGAHDGHLRKEGWRS 110
>META_THEMA (Q9WZY3) Homoserine O-succinyltransferase (EC 2.3.1.46) (Homoserine| O-transsuccinylase) (HTS) Length = 304 Score = 27.7 bits (60), Expect = 7.4 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = -3 Query: 238 EWTRXAGFLTLFLCWSASISMIF 170 EW+R + T+F+CW+A + + Sbjct: 129 EWSRHNVYSTMFICWAAQAGLYY 151
>RAI1_HUMAN (Q7Z5J4) Retinoic acid-induced protein 1| Length = 1906 Score = 27.3 bits (59), Expect = 9.7 Identities = 11/36 (30%), Positives = 20/36 (55%) Frame = -1 Query: 306 HXYETSNPAYAETSQRPLXAARTNGPGXPVSSLYSF 199 H Y++ A+ RPL A+ + PG V +L+++ Sbjct: 234 HSYKSCTAPTAQPHDRPLTASSSLAPGQRVQNLHAY 269
>BYR4_SCHPO (Q10951) Protein byr4| Length = 665 Score = 27.3 bits (59), Expect = 9.7 Identities = 11/39 (28%), Positives = 23/39 (58%) Frame = +2 Query: 104 SKHKTMLTGSTTDSRHGMXNAEKNHRYAGAPAKE*SEET 220 SKH+ L T +++ +++ H+ AP+KE ++E+ Sbjct: 434 SKHENNLNNITNSAKNEHIRSQRQHKTHAAPSKELTKES 472 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 44,239,665 Number of Sequences: 219361 Number of extensions: 749227 Number of successful extensions: 1750 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1727 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1750 length of database: 80,573,946 effective HSP length: 87 effective length of database: 61,489,539 effective search space used: 1475748936 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)