| Clone Name | rbags17c08 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | MTH1_DROME (Q9VXD9) Probable G-protein coupled receptor Mth-like... | 30 | 1.5 | 2 | MCH1_GIBZE (Q4IM48) Probable transporter MCH1 | 29 | 2.6 |
|---|
>MTH1_DROME (Q9VXD9) Probable G-protein coupled receptor Mth-like 1 precursor| (Protein methuselah-like 1) Length = 676 Score = 30.0 bits (66), Expect = 1.5 Identities = 12/37 (32%), Positives = 19/37 (51%) Frame = +1 Query: 172 NKQTQIFTSPHRPLGFMICENTXLGVSPSESMLATLW 282 N+ IF + P+G ++C N L VS + + LW Sbjct: 484 NRNLSIFAYFYGPIGLLLCANIALFVSTTHQLTCGLW 520
>MCH1_GIBZE (Q4IM48) Probable transporter MCH1| Length = 572 Score = 29.3 bits (64), Expect = 2.6 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = -1 Query: 170 VSHPWGLPXLFIQHIFMSLCSCCL 99 V + W LP L + +F+ + +CCL Sbjct: 151 VDNDWSLPFLMLSFVFVGVATCCL 174 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 34,640,165 Number of Sequences: 219361 Number of extensions: 548119 Number of successful extensions: 830 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 827 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 830 length of database: 80,573,946 effective HSP length: 78 effective length of database: 63,463,788 effective search space used: 1523130912 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)