>POLG_MCFA (P33515) Genome polyprotein [Contains: Capsid protein C (Core|
           protein); Envelope protein M (Matrix protein); Major
           envelope protein E; Nonstructural protein 1 (NS1);
           Nonstructural protein 2A (NS2A); Flavivirin protease
           NS2B regulatory subunit;
          Length = 3341

 Score = 29.3 bits (64), Expect = 9.9
 Identities = 21/68 (30%), Positives = 39/68 (57%), Gaps = 2/68 (2%)
 Frame = -2

Query: 256 D*INLAIHVALVVRFLYDAPDQAVDALNKVTVEHQILHRTQIGP*SIVRIV--VSLLNGC 83
           D +   IH+ALV+  L+ + D+ + +L++  V      RT   P ++  I+  +++L GC
Sbjct: 78  DIVQALIHMALVLHALFASIDRRIRSLSR-RVTALESRRTTGNPMTLAFILGFLTVLCGC 136

Query: 82  VPIDLLIS 59
           V ID+ +S
Sbjct: 137 VVIDMQVS 144


  Database: uniprot_sprot.fasta
    Posted date:  May 25, 2006  5:36 PM
  Number of letters in database: 80,573,946
  Number of sequences in database:  219,361
  
Lambda     K      H
   0.318    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 86,477,449
Number of Sequences: 219361
Number of extensions: 1680161
Number of successful extensions: 3652
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 3563
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3652
length of database: 80,573,946
effective HSP length: 107
effective length of database: 57,102,319
effective search space used: 5710231900
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)