| Clone Name | rbags16m05 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | RM12_CRICR (P52827) 39S ribosomal protein L12, mitochondrial pre... | 30 | 2.2 | 2 | RBBP5_HUMAN (Q15291) Retinoblastoma-binding protein 5 (RBBP-5) (... | 28 | 8.2 | 3 | ALU4_HUMAN (P39191) Alu subfamily SB2 sequence contamination war... | 28 | 8.2 |
|---|
>RM12_CRICR (P52827) 39S ribosomal protein L12, mitochondrial precursor (L12mt)| (MRP-L12) (P2A1) Length = 203 Score = 29.6 bits (65), Expect = 2.2 Identities = 15/38 (39%), Positives = 22/38 (57%) Frame = +3 Query: 39 IPVAVPSIVYEAPRLGRRTAKISASRQEEHGAXQARKL 152 +P A + APRLG R A++ +RQ+ G AR+L Sbjct: 2 LPAAAAAASLWAPRLGLRGARLRLARQQVPGVCAARQL 39
>RBBP5_HUMAN (Q15291) Retinoblastoma-binding protein 5 (RBBP-5)| (Retinoblastoma-binding protein RBQ-3) Length = 538 Score = 27.7 bits (60), Expect = 8.2 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +2 Query: 86 KEDGKNLSQQAGRARSXSGQEASAP 160 K DGK+ +QAGR + G+E +P Sbjct: 474 KGDGKSKKKQAGRPKGSKGKEKDSP 498
>ALU4_HUMAN (P39191) Alu subfamily SB2 sequence contamination warning entry| Length = 603 Score = 27.7 bits (60), Expect = 8.2 Identities = 13/30 (43%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Frame = -3 Query: 149 LPGLX-CSVLFLPAG*DFCRPPSKPGSFIH 63 LPG S L LP+ D+ RPP +P +F++ Sbjct: 332 LPGFTPFSCLSLPSSWDYRRPPPRPANFLY 361 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 30,950,226 Number of Sequences: 219361 Number of extensions: 498934 Number of successful extensions: 1581 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1567 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1581 length of database: 80,573,946 effective HSP length: 57 effective length of database: 68,070,369 effective search space used: 1633688856 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)