| Clone Name | rbags16l14 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | UBP33_HUMAN (Q8TEY7) Ubiquitin carboxyl-terminal hydrolase 33 (E... | 30 | 3.3 |
|---|
>UBP33_HUMAN (Q8TEY7) Ubiquitin carboxyl-terminal hydrolase 33 (EC 3.1.2.15)| (Ubiquitin thioesterase 33) (Ubiquitin-specific-processing protease 33) (Deubiquitinating enzyme 33) (VHL-interacting deubiquitinating enzyme 1) Length = 942 Score = 30.4 bits (67), Expect = 3.3 Identities = 10/32 (31%), Positives = 19/32 (59%) Frame = -2 Query: 309 SREAFVPKTVGRCRDGNKKKGNRWSCVRENCS 214 ++E + K++G C+D + N W+C+ CS Sbjct: 49 TKEDLIQKSLGTCQDCKVQGPNLWACLENRCS 80 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 67,710,262 Number of Sequences: 219361 Number of extensions: 1222124 Number of successful extensions: 2034 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1991 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2034 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4258037034 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)