| Clone Name | rbags17a01 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | HEY1_HUMAN (Q9Y5J3) Hairy/enhancer-of-split related with YRPW mo... | 30 | 4.6 | 2 | HEY1_CANFA (Q9TSZ2) Hairy/enhancer-of-split related with YRPW mo... | 30 | 4.6 | 3 | HEY1_MOUSE (Q9WV93) Hairy/enhancer-of-split related with YRPW mo... | 30 | 4.6 | 4 | MARF_DROME (Q7YU24) Transmembrane GTPase Marf (EC 3.6.5.-) (Mito... | 30 | 6.1 |
|---|
>HEY1_HUMAN (Q9Y5J3) Hairy/enhancer-of-split related with YRPW motif 1 (Hairy| and enhancer of split related 1) (HESR-1) (Cardiovascular helix-loop-helix factor 2) (HES-related repressor protein 2) (HERP2) Length = 304 Score = 30.4 bits (67), Expect = 4.6 Identities = 18/44 (40%), Positives = 26/44 (59%) Frame = -2 Query: 465 KRRRGMSILRRRYRLLNTLGWISKLHVSQFKTQKDGLLLSSKIL 334 KRRRG+ RRR R+ N+L + +L S F+ Q L ++IL Sbjct: 51 KRRRGIIEKRRRDRINNSLSELRRLVPSAFEKQGSAKLEKAEIL 94
>HEY1_CANFA (Q9TSZ2) Hairy/enhancer-of-split related with YRPW motif 1 (Hairy| and enhancer of split related 1) (HESR-1) Length = 304 Score = 30.4 bits (67), Expect = 4.6 Identities = 18/44 (40%), Positives = 26/44 (59%) Frame = -2 Query: 465 KRRRGMSILRRRYRLLNTLGWISKLHVSQFKTQKDGLLLSSKIL 334 KRRRG+ RRR R+ N+L + +L S F+ Q L ++IL Sbjct: 51 KRRRGIIEKRRRDRINNSLSELRRLVPSAFEKQGSAKLEKAEIL 94
>HEY1_MOUSE (Q9WV93) Hairy/enhancer-of-split related with YRPW motif 1 (Hairy| and enhancer of split-related 1) (HESR-1) Length = 299 Score = 30.4 bits (67), Expect = 4.6 Identities = 18/44 (40%), Positives = 26/44 (59%) Frame = -2 Query: 465 KRRRGMSILRRRYRLLNTLGWISKLHVSQFKTQKDGLLLSSKIL 334 KRRRG+ RRR R+ N+L + +L S F+ Q L ++IL Sbjct: 51 KRRRGIIEKRRRDRINNSLSELRRLVPSAFEKQGSAKLEKAEIL 94
>MARF_DROME (Q7YU24) Transmembrane GTPase Marf (EC 3.6.5.-) (Mitochondrial| assembly regulatory factor) (Mitofusin) Length = 810 Score = 30.0 bits (66), Expect = 6.1 Identities = 17/58 (29%), Positives = 30/58 (51%) Frame = -1 Query: 586 SSTYTRLQYTFDTCVEGISDETPEDEGRMLITKAVWSKLHKEKTWDEYIKEKIQIAKH 413 SST+ RL T DT ++DE + ++ I +A +L + YI+ ++ I +H Sbjct: 747 SSTFARLCRTVDTATTDMNDELKTLDSQLNILEANQKQLKLLRNKANYIQNELDIFEH 804 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 94,763,797 Number of Sequences: 219361 Number of extensions: 2000659 Number of successful extensions: 4411 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4281 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4411 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5995743495 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)