| Clone Name | rbags16j07 |
|---|---|
| Clone Library Name | barley_pub |
>CHAC_ECOLI (P39163) Cation transport protein chaC| Length = 231 Score = 40.0 bits (92), Expect = 0.004 Identities = 20/46 (43%), Positives = 28/46 (60%) Frame = -1 Query: 499 IATASGPNGYNRDYLFSMEKALSNISHEDDSIIVLADEVRKVLGRS 362 IA ASGP G N YLFS+E+ L + +DD + L V+K+L + Sbjct: 175 IAAASGPLGTNAQYLFSLEQELIKLGMQDDGLNDLLVSVKKLLAEN 220
>VG20_BPT4 (P13334) Structural protein of head (Tail tube protein Gp20)| Length = 524 Score = 32.7 bits (73), Expect = 0.57 Identities = 13/36 (36%), Positives = 22/36 (61%) Frame = +2 Query: 329 WYVGAGNLLLCRPAQHLPHLIRKHNDRVVFMAYIGQ 436 WYV GN+ + A+H+ H++ +RVV+ A G+ Sbjct: 285 WYVDTGNMPARKAAEHMQHVMNTMKNRVVYDASTGK 320
>DCE2_HUMAN (Q05329) Glutamate decarboxylase 2 (EC 4.1.1.15) (Glutamate| decarboxylase, 65 kDa isoform) (GAD-65) (65 kDa glutamic acid decarboxylase) Length = 585 Score = 30.4 bits (67), Expect = 2.8 Identities = 15/41 (36%), Positives = 24/41 (58%) Frame = -2 Query: 270 FQHSKKSGMAGLAKQMAFSSDHTHS*HSPIERSAVYFGSGT 148 F K+ GMA L + +AF+S+H+ H +++ A G GT Sbjct: 259 FPEVKEKGMAALPRLIAFTSEHS---HFSLKKGAAALGIGT 296
>DOCK1_MOUSE (Q8BUR4) Dedicator of cytokinesis protein 1 (180 kDa protein| downstream of CRK) (DOCK180) (Fragments) Length = 1027 Score = 29.6 bits (65), Expect = 4.8 Identities = 18/54 (33%), Positives = 26/54 (48%), Gaps = 1/54 (1%) Frame = +3 Query: 186 ENVKSEYGQRKMPS-VSLIQPCRSSCYVETATVPSGRAEMCTAGVCDFNGTSEP 344 E V+ +YG R MPS + + R V + T+PS + A V F+ S P Sbjct: 768 EKVEKQYGVRTMPSGLDDRRGSRPRSMVRSFTMPSSSRPLSVASVSSFSSDSTP 821
>DCE2_RAT (Q05683) Glutamate decarboxylase 2 (EC 4.1.1.15) (Glutamate| decarboxylase, 65 kDa isoform) (GAD-65) (65 kDa glutamic acid decarboxylase) Length = 585 Score = 29.3 bits (64), Expect = 6.3 Identities = 14/41 (34%), Positives = 24/41 (58%) Frame = -2 Query: 270 FQHSKKSGMAGLAKQMAFSSDHTHS*HSPIERSAVYFGSGT 148 F K+ GMA + + +AF+S+H+ H +++ A G GT Sbjct: 259 FPEVKEKGMAAVPRLIAFTSEHS---HFSLKKGAAALGIGT 296
>DCE2_PIG (P48321) Glutamate decarboxylase 2 (EC 4.1.1.15) (Glutamate| decarboxylase, 65 kDa isoform) (GAD-65) (65 kDa glutamic acid decarboxylase) Length = 585 Score = 29.3 bits (64), Expect = 6.3 Identities = 14/41 (34%), Positives = 24/41 (58%) Frame = -2 Query: 270 FQHSKKSGMAGLAKQMAFSSDHTHS*HSPIERSAVYFGSGT 148 F K+ GMA + + +AF+S+H+ H +++ A G GT Sbjct: 259 FPEVKEKGMAAVPRLIAFTSEHS---HFSLKKGAAALGIGT 296
>DCE2_MOUSE (P48320) Glutamate decarboxylase 2 (EC 4.1.1.15) (Glutamate| decarboxylase, 65 kDa isoform) (GAD-65) (65 kDa glutamic acid decarboxylase) Length = 585 Score = 29.3 bits (64), Expect = 6.3 Identities = 14/41 (34%), Positives = 24/41 (58%) Frame = -2 Query: 270 FQHSKKSGMAGLAKQMAFSSDHTHS*HSPIERSAVYFGSGT 148 F K+ GMA + + +AF+S+H+ H +++ A G GT Sbjct: 259 FPEVKEKGMAAVPRLIAFTSEHS---HFSLKKGAAALGIGT 296
>DCE2_CANFA (Q4PRC2) Glutamate decarboxylase 2 (EC 4.1.1.15) (Glutamate| decarboxylase, 65 kDa isoform) (GAD-65) (65 kDa glutamic acid decarboxylase) Length = 585 Score = 29.3 bits (64), Expect = 6.3 Identities = 14/41 (34%), Positives = 24/41 (58%) Frame = -2 Query: 270 FQHSKKSGMAGLAKQMAFSSDHTHS*HSPIERSAVYFGSGT 148 F K+ GMA + + +AF+S+H+ H +++ A G GT Sbjct: 259 FPEVKEKGMAAVPRLIAFTSEHS---HFSLKKGAAALGIGT 296
>VATI1_TREPA (O83444) V-type ATP synthase subunit I 1 (EC 3.6.3.14) (V-type| ATPase subunit I 1) Length = 622 Score = 29.3 bits (64), Expect = 6.3 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = +2 Query: 368 AQHLPHLIRKHNDRVVFMAYIGQCLLH*EQVVP 466 A+ + ++R H+DRV I QC+ H E+ P Sbjct: 83 AEAVEQIVRTHSDRVELAQRIAQCIAHLERCEP 115
>PGK_HELHP (Q7VJB6) Phosphoglycerate kinase (EC 2.7.2.3)| Length = 402 Score = 28.9 bits (63), Expect = 8.2 Identities = 23/71 (32%), Positives = 32/71 (45%), Gaps = 9/71 (12%) Frame = -1 Query: 454 FSMEKALSNISHEDDSIIVLADEVRKVLGRSTEKK---------VTGSDVPLKSHTPAVH 302 F M+K+L EDD L E RK+L ++ EKK V+ D+ H Sbjct: 240 FDMQKSLV----EDD----LVSEARKILDKAKEKKVKIYLPVDVVSTDDIKEHRHIKITP 291 Query: 301 ISALPEGTVAV 269 +PEG +AV Sbjct: 292 AQDIPEGFMAV 302 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 68,287,209 Number of Sequences: 219361 Number of extensions: 1319937 Number of successful extensions: 3023 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 2970 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3023 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3638905326 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)