| Clone Name | rbags16j03 |
|---|---|
| Clone Library Name | barley_pub |
>DCN1L_DROME (Q9VUQ8) DCN1-like protein (Defective in cullin neddylation protein| 1-like protein) Length = 288 Score = 59.3 bits (142), Expect = 6e-09 Identities = 25/40 (62%), Positives = 29/40 (72%) Frame = -3 Query: 500 DTWXQLLEFVKTIDPELSNYDEEGAWPYLIDEFVEYLTEN 381 DTW LL+F ID +SNYD EGAWP LID+FVE+ EN Sbjct: 207 DTWNLLLDFATNIDDRMSNYDSEGAWPVLIDDFVEWCQEN 246
>DCNL2_MOUSE (Q8BZJ7) DCN1-like protein 2 (Defective in cullin neddylation| protein 2-like protein 2) (DCUN1 domain-containing protein 2) Length = 258 Score = 57.0 bits (136), Expect = 3e-08 Identities = 25/36 (69%), Positives = 28/36 (77%) Frame = -3 Query: 500 DTWXQLLEFVKTIDPELSNYDEEGAWPYLIDEFVEY 393 DTW LL+F I +LSNYDEEGAWP LID+FVEY Sbjct: 210 DTWNLLLDFGNMIADDLSNYDEEGAWPVLIDDFVEY 245
>DCNL2_HUMAN (Q6PH85) DCN1-like protein 2 (Defective in cullin neddylation| protein 2-like protein 2) (DCUN1 domain-containing protein 2) Length = 259 Score = 56.2 bits (134), Expect = 5e-08 Identities = 24/36 (66%), Positives = 28/36 (77%) Frame = -3 Query: 500 DTWXQLLEFVKTIDPELSNYDEEGAWPYLIDEFVEY 393 DTW LL+F I ++SNYDEEGAWP LID+FVEY Sbjct: 211 DTWNLLLDFGNMIADDMSNYDEEGAWPVLIDDFVEY 246
>DCNL4_BRARE (Q5RHX6) DCN1-like protein 4 (Defective in cullin neddylation| protein 1-like protein 4) (DCUN1 domain-containing protein 4) Length = 280 Score = 56.2 bits (134), Expect = 5e-08 Identities = 23/36 (63%), Positives = 30/36 (83%) Frame = -3 Query: 500 DTWXQLLEFVKTIDPELSNYDEEGAWPYLIDEFVEY 393 D W +LEF +TI+ +LSNYDE+GAWP L+DEFVE+ Sbjct: 238 DQWCNVLEFSRTINLDLSNYDEDGAWPVLLDEFVEW 273
>DCNL4_HUMAN (Q92564) DCN1-like protein 4 (Defective in cullin neddylation| protein 1-like protein 4) (DCUN1 domain-containing protein 4) Length = 292 Score = 56.2 bits (134), Expect = 5e-08 Identities = 23/36 (63%), Positives = 30/36 (83%) Frame = -3 Query: 500 DTWXQLLEFVKTIDPELSNYDEEGAWPYLIDEFVEY 393 D W +LEF +TI+ +LSNYDE+GAWP L+DEFVE+ Sbjct: 250 DQWCNVLEFSRTINLDLSNYDEDGAWPVLLDEFVEW 285
>DCNL4_MOUSE (Q8CCA0) DCN1-like protein 4 (Defective in cullin neddylation| protein 1-like protein 4) (DCUN1 domain-containing protein 4) Length = 292 Score = 55.8 bits (133), Expect = 6e-08 Identities = 23/36 (63%), Positives = 29/36 (80%) Frame = -3 Query: 500 DTWXQLLEFVKTIDPELSNYDEEGAWPYLIDEFVEY 393 D W +LEF +TI +LSNYDE+GAWP L+DEFVE+ Sbjct: 250 DQWCNVLEFSRTISLDLSNYDEDGAWPVLLDEFVEW 285
>DCN1_CAEEL (Q9U3C8) Defective in cullin neddylation protein 1| Length = 295 Score = 55.1 bits (131), Expect = 1e-07 Identities = 22/40 (55%), Positives = 29/40 (72%) Frame = -3 Query: 500 DTWXQLLEFVKTIDPELSNYDEEGAWPYLIDEFVEYLTEN 381 DTW +F+ P+LS+YD+EGAWP LID+FV+Y EN Sbjct: 235 DTWNLFWDFILLSKPDLSDYDDEGAWPVLIDQFVDYCREN 274
>DCNL1_MOUSE (Q9QZ73) DCN1-like protein 1 (Defective in cullin neddylation| protein 1-like protein 1) (DCUN1 domain-containing protein 1) (Testis-specific protein 3) Length = 259 Score = 55.1 bits (131), Expect = 1e-07 Identities = 23/36 (63%), Positives = 28/36 (77%) Frame = -3 Query: 500 DTWXQLLEFVKTIDPELSNYDEEGAWPYLIDEFVEY 393 DTW LL+F I ++SNYDEEGAWP LID+FVE+ Sbjct: 211 DTWNLLLDFSSMIADDMSNYDEEGAWPVLIDDFVEF 246
>DCN1_CRYNE (Q5KHV1) Defective in cullin neddylation protein 1| Length = 279 Score = 55.1 bits (131), Expect = 1e-07 Identities = 21/39 (53%), Positives = 29/39 (74%) Frame = -3 Query: 500 DTWXQLLEFVKTIDPELSNYDEEGAWPYLIDEFVEYLTE 384 DTW L++F + ID + YDE+GAWP +ID+FVEY+ E Sbjct: 236 DTWALLVDFARGIDKDFKEYDEDGAWPSMIDDFVEYVRE 274
>DCNL1_HUMAN (Q96GG9) DCN1-like protein 1 (Defective in cullin neddylation| protein 1-like protein 1) (DCUN1 domain-containing protein 1) (Squamous cell carcinoma-related oncogene) Length = 259 Score = 54.7 bits (130), Expect = 1e-07 Identities = 23/36 (63%), Positives = 28/36 (77%) Frame = -3 Query: 500 DTWXQLLEFVKTIDPELSNYDEEGAWPYLIDEFVEY 393 DTW LL+F I ++SNYDEEGAWP LID+FVE+ Sbjct: 211 DTWNLLLDFSTMIADDMSNYDEEGAWPVLIDDFVEF 246
>DCNL1_CHICK (Q5ZKU1) DCN1-like protein 1 (Defective in cullin neddylation| protein 1-like protein 1) (DCUN1 domain-containing protein 1) Length = 259 Score = 54.7 bits (130), Expect = 1e-07 Identities = 23/36 (63%), Positives = 28/36 (77%) Frame = -3 Query: 500 DTWXQLLEFVKTIDPELSNYDEEGAWPYLIDEFVEY 393 DTW LL+F I ++SNYDEEGAWP LID+FVE+ Sbjct: 211 DTWNLLLDFSTMIADDMSNYDEEGAWPVLIDDFVEF 246
>DCN1_SCHPO (Q8WZK4) Defective in cullin neddylation protein 1| Length = 251 Score = 53.1 bits (126), Expect = 4e-07 Identities = 25/43 (58%), Positives = 29/43 (67%), Gaps = 2/43 (4%) Frame = -3 Query: 500 DTWXQLLEFVKTI--DPELSNYDEEGAWPYLIDEFVEYLTENG 378 DTW +L +F + DP SNYD EGAWP LIDEFV Y E+G Sbjct: 203 DTWNELWDFSVFVKSDPNCSNYDFEGAWPTLIDEFVSYYREHG 245
>DCN1_CAEBR (Q60YT5) Defective in cullin neddylation protein 1| Length = 292 Score = 50.4 bits (119), Expect = 3e-06 Identities = 21/40 (52%), Positives = 28/40 (70%) Frame = -3 Query: 500 DTWXQLLEFVKTIDPELSNYDEEGAWPYLIDEFVEYLTEN 381 DTW +F+ +LS+YDEEGAWP LID+FV++ EN Sbjct: 233 DTWNLFWDFIVLGKEDLSDYDEEGAWPVLIDQFVDHCREN 272
>DCN1_YARLI (Q6C0B6) Defective in cullin neddylation protein 1| Length = 240 Score = 50.4 bits (119), Expect = 3e-06 Identities = 22/41 (53%), Positives = 29/41 (70%), Gaps = 2/41 (4%) Frame = -3 Query: 500 DTWXQLLEFV--KTIDPELSNYDEEGAWPYLIDEFVEYLTE 384 D W L EF+ + DP L +YDE+GAWP +IDE+VE+L E Sbjct: 200 DAWNMLYEFMLFQAKDPSLESYDEDGAWPSVIDEYVEFLKE 240
>DCN1_USTMA (Q4PF67) Defective in cullin neddylation protein 1| Length = 319 Score = 49.3 bits (116), Expect = 6e-06 Identities = 19/40 (47%), Positives = 29/40 (72%) Frame = -3 Query: 500 DTWXQLLEFVKTIDPELSNYDEEGAWPYLIDEFVEYLTEN 381 DTW Q L+F K I+ + SN+D + AWP +ID+FV ++ +N Sbjct: 270 DTWMQFLDFTKEINSDFSNHDFDAAWPSIIDDFVLWVRDN 309
>DCN1_YEAST (Q12395) Defective in cullin neddylation protein 1| Length = 269 Score = 45.4 bits (106), Expect = 8e-05 Identities = 22/42 (52%), Positives = 27/42 (64%), Gaps = 3/42 (7%) Frame = -3 Query: 500 DTWXQLLEFVK---TIDPELSNYDEEGAWPYLIDEFVEYLTE 384 DTW LL F K TI +S+YDE AWP++IDEF E L + Sbjct: 226 DTWRMLLLFFKRYPTIQKIISDYDETAAWPFIIDEFYECLQD 267
>DCN1_CANGA (Q6FJR2) Defective in cullin neddylation protein 1| Length = 273 Score = 45.1 bits (105), Expect = 1e-04 Identities = 22/42 (52%), Positives = 26/42 (61%), Gaps = 3/42 (7%) Frame = -3 Query: 500 DTWXQLLEFVK---TIDPELSNYDEEGAWPYLIDEFVEYLTE 384 DTW LL F K ++D + Y+E AWPY IDEF EYL E Sbjct: 228 DTWQMLLLFFKKFPSLDAIKTEYNEADAWPYTIDEFYEYLEE 269
>DCN1_MAGGR (Q52DM9) Defective in cullin neddylation protein 1| Length = 281 Score = 40.8 bits (94), Expect = 0.002 Identities = 20/43 (46%), Positives = 25/43 (58%), Gaps = 2/43 (4%) Frame = -3 Query: 500 DTWXQLLEFV--KTIDPELSNYDEEGAWPYLIDEFVEYLTENG 378 D W Q L+F T D LS + EG+WP +ID FVE+L G Sbjct: 228 DMWNQTLDFAVKSTADSTLSFWTPEGSWPSVIDGFVEWLRNKG 270
>DCN1_CANAL (Q5ADL9) Defective in cullin neddylation protein 1| Length = 304 Score = 39.3 bits (90), Expect = 0.006 Identities = 19/41 (46%), Positives = 25/41 (60%), Gaps = 4/41 (9%) Frame = -3 Query: 500 DTWXQLLEFVKTI---DP-ELSNYDEEGAWPYLIDEFVEYL 390 D+W F K I DP + +YDE AWP ++DEF+EYL Sbjct: 258 DSWSMFYLFFKEIVLIDPIKFKDYDEMAAWPSVVDEFLEYL 298
>DCN1_ASHGO (Q750Y3) Defective in cullin neddylation protein 1| Length = 256 Score = 31.2 bits (69), Expect = 1.6 Identities = 13/40 (32%), Positives = 22/40 (55%), Gaps = 3/40 (7%) Frame = -3 Query: 500 DTWXQLLEFVKTIDPE---LSNYDEEGAWPYLIDEFVEYL 390 DTW F + + L +Y+E +WP +IDE+ E++ Sbjct: 211 DTWDMFPRFAQRFPDDTELLEHYNELASWPLVIDEYYEWV 250
>FIBG_HUMAN (P02679) Fibrinogen gamma chain precursor| Length = 453 Score = 31.2 bits (69), Expect = 1.6 Identities = 21/45 (46%), Positives = 25/45 (55%), Gaps = 6/45 (13%) Frame = -3 Query: 194 DFTG*DCK------LYQSGLYFVLPLSATAYPKHLLVYC*MGDGS 78 D TG DC+ QSGLYF+ PL A + LVYC + DGS Sbjct: 173 DITGKDCQDIANKGAKQSGLYFIKPLKAN---QQFLVYCEI-DGS 213
>FIBG_BOVIN (P12799) Fibrinogen gamma-B chain precursor (Gamma')| Length = 444 Score = 30.8 bits (68), Expect = 2.1 Identities = 21/45 (46%), Positives = 25/45 (55%), Gaps = 6/45 (13%) Frame = -3 Query: 194 DFTG*DCK------LYQSGLYFVLPLSATAYPKHLLVYC*MGDGS 78 D TG DC+ +SGLYF+ PL A K LVYC + DGS Sbjct: 171 DVTGRDCQDVANKGAKESGLYFIRPLKA----KQFLVYCEI-DGS 210
>RPOB_BARQU (Q9KJM5) DNA-directed RNA polymerase beta chain (EC 2.7.7.6) (RNAP| beta subunit) (Transcriptase beta chain) (RNA polymerase beta subunit) Length = 1383 Score = 29.6 bits (65), Expect = 4.7 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = +3 Query: 3 PSCQQYDQYRYHKFALPHTWTCMNYRPIAH 92 PS D YR KF + TC+N RP+ H Sbjct: 756 PSKSGVDIYRLQKFQRSNQSTCINQRPLVH 785
>RPOB_BARHE (Q9KJG4) DNA-directed RNA polymerase beta chain (EC 2.7.7.6) (RNAP| beta subunit) (Transcriptase beta chain) (RNA polymerase beta subunit) Length = 1383 Score = 29.6 bits (65), Expect = 4.7 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = +3 Query: 3 PSCQQYDQYRYHKFALPHTWTCMNYRPIAH 92 PS D YR KF + TC+N RP+ H Sbjct: 756 PSKSGVDIYRLQKFQRSNQSTCINQRPLVH 785
>GR05A_DROME (Q9W497) Gustatory receptor for trehalose (Trehalose receptor)| Length = 444 Score = 29.6 bits (65), Expect = 4.7 Identities = 20/64 (31%), Positives = 25/64 (39%) Frame = -2 Query: 213 NLLAQG*FHWLGLQTLSIWFVFCAAPICYSLPKTLIGLLLNGRWVYSSCRSRYEVMRTCD 34 N L G FH L++ FC P+C T GL N R S R Y + C Sbjct: 46 NFLHDGSFHEAVAPVLAVAQCFCLMPVCGISAPTYRGLSFNRR----SWRFWYSSLYLCS 101 Query: 33 IGID 22 +D Sbjct: 102 TSVD 105
>DCN1_EMENI (Q5AWS1) Defective in cullin neddylation protein 1| Length = 308 Score = 29.6 bits (65), Expect = 4.7 Identities = 13/39 (33%), Positives = 22/39 (56%), Gaps = 2/39 (5%) Frame = -3 Query: 500 DTWXQLLEFVKTI--DPELSNYDEEGAWPYLIDEFVEYL 390 D W Q+ F++ D + E+GAWP +D+FV ++ Sbjct: 258 DLWQQVEVFMRKTHEDEAFGWWSEDGAWPGTLDDFVAWV 296
>FIBG_MOUSE (Q8VCM7) Fibrinogen gamma chain precursor| Length = 436 Score = 28.9 bits (63), Expect = 8.1 Identities = 20/45 (44%), Positives = 25/45 (55%), Gaps = 6/45 (13%) Frame = -3 Query: 194 DFTG*DCK------LYQSGLYFVLPLSATAYPKHLLVYC*MGDGS 78 D TG DC+ +SGLYF+ PL A + LVYC + DGS Sbjct: 172 DTTGKDCQEIANKGAKESGLYFIRPLKA---KQQFLVYCEI-DGS 212 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 76,912,680 Number of Sequences: 219361 Number of extensions: 1654972 Number of successful extensions: 3258 Number of sequences better than 10.0: 27 Number of HSP's better than 10.0 without gapping: 3209 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3258 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3581144924 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)