| Clone Name | rbags16i14 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | TOXR_VIBPA (Q05938) Cholera toxin homolog transcriptional activator | 30 | 3.3 | 2 | MTH_DROSI (P83120) G-protein coupled receptor Mth precursor (Pro... | 30 | 5.6 |
|---|
>TOXR_VIBPA (Q05938) Cholera toxin homolog transcriptional activator| Length = 292 Score = 30.4 bits (67), Expect = 3.3 Identities = 21/74 (28%), Positives = 33/74 (44%) Frame = -3 Query: 536 EVRDSDLVKDVETIAKGLAEASGDLRRLKSSMLTPENSDLIKQSIFTLIFTLKNIESISS 357 EV DS L + + T+ K LK S +PE + + + LI T++ + +SS Sbjct: 70 EVDDSSLTQAISTLRK----------MLKDSTKSPEFVKTVPKRGYQLICTVERLSPLSS 119 Query: 356 DISGFTGDEATRQN 315 D S +E N Sbjct: 120 DSSSIEVEEPASDN 133
>MTH_DROSI (P83120) G-protein coupled receptor Mth precursor (Protein| methuselah) Length = 515 Score = 29.6 bits (65), Expect = 5.6 Identities = 19/55 (34%), Positives = 29/55 (52%), Gaps = 2/55 (3%) Frame = -1 Query: 205 RLKHL*EKLIIVEVCQFFS*YFFCILDIK--SSIYCRCRGVIAGRFLCAARLWLS 47 +L++L K I + F Y F + D+ S +C+ GV+ F+ AA LWLS Sbjct: 241 KLQNLHGKCFICYMVCLFMGYLFLLFDLWQISISFCKPAGVLGYFFVMAAFLWLS 295 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 63,030,885 Number of Sequences: 219361 Number of extensions: 1022867 Number of successful extensions: 2565 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2465 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2565 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4200495993 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)