| Clone Name | rbags16h16 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | YKD8_YEAST (P32862) Putative 128.2 kDa transcriptional regulator... | 31 | 2.3 |
|---|
>YKD8_YEAST (P32862) Putative 128.2 kDa transcriptional regulatory protein in| PTM1-IXR1 intergenic region Length = 1170 Score = 30.8 bits (68), Expect = 2.3 Identities = 14/45 (31%), Positives = 26/45 (57%) Frame = +3 Query: 90 SNTMXTLLYNTPRLFSGRGQSELPPPQHSSEQHSKQPRKERAAHI 224 S+++ +LL NT GQ +LPPPQ S+ + Q + ++ ++ Sbjct: 282 SSSIPSLLRNTSNSLLLGGQPQLPPPQQQSQPQAHQQKLQQGQNL 326 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 47,453,031 Number of Sequences: 219361 Number of extensions: 654830 Number of successful extensions: 1980 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1924 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1980 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3927707336 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)