ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbags16g07 |
|---|---|
| Clone Library Name | barley_pub |
>THUM1_HUMAN (Q9NXG2) THUMP domain-containing protein 1| Length = 353 Score = 35.8 bits (81), Expect = 0.027 Identities = 13/38 (34%), Positives = 24/38 (63%) Frame = -2 Query: 347 PDKTIIVQIAKTICMIGVVERYKELSKFNLRQLTSPPE 234 P T++V+I K +C + VV+ Y K+NL+++ P+ Sbjct: 235 PQYTVVVEIIKAVCCLSVVKDYMLFRKYNLQEVVKSPK 272
>YB0A_SCHPO (P87151) Hypothetical protein C25H2.10c in chromosome II| Length = 287 Score = 34.7 bits (78), Expect = 0.060 Identities = 18/56 (32%), Positives = 34/56 (60%), Gaps = 1/56 (1%) Frame = -2 Query: 335 IIVQIAKTICMIGVVERYKELSKFNLRQLTSPPEK*FLTPGAVCL-SFNQMRHQLV 171 I+VQ+ K I I +V+ ++EL +FNL ++ PE P L +F++ ++Q++ Sbjct: 224 ILVQVIKNIIGISIVQNFEELRRFNLNEVYKQPENTKSIPNDSKLDNFDRDKNQII 279
>THUM1_MOUSE (Q99J36) THUMP domain-containing protein 1| Length = 350 Score = 33.5 bits (75), Expect = 0.13 Identities = 12/33 (36%), Positives = 23/33 (69%) Frame = -2 Query: 347 PDKTIIVQIAKTICMIGVVERYKELSKFNLRQL 249 P+ T++V+I K +C + VV+ Y K+NL+++ Sbjct: 235 PEYTVVVEIIKAVCCLSVVKDYVLFRKYNLQEV 267
>ZAN_RABIT (P57999) Zonadhesin (Fragment)| Length = 2282 Score = 28.1 bits (61), Expect = 5.6 Identities = 8/23 (34%), Positives = 14/23 (60%) Frame = -1 Query: 348 PRQDYYCPDCQDYMHDWSGGEIQ 280 P +++ P+C + H W GG I+ Sbjct: 561 PEAEWFSPNCTELCHCWPGGRIE 583
>CRTW_PARSN (P54972) Beta-carotene ketolase (EC 1.13.-.-) (Beta-carotene| oxygenase) Length = 242 Score = 28.1 bits (61), Expect = 5.6 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = -1 Query: 111 IIMSLKWTAVVVWMHPELLAYCRLLQFGT 25 +I+ +W VV W P +LA +L FGT Sbjct: 152 LILGDRWMYVVFWPLPSILASIQLFVFGT 180
>SWR1_DEBHA (Q6BKC2) Helicase SWR1 (EC 3.6.1.-)| Length = 1616 Score = 27.7 bits (60), Expect = 7.3 Identities = 11/42 (26%), Positives = 25/42 (59%) Frame = +1 Query: 211 APGVRNYFSGGEVSCLRLNFESSLYLSTTPIMHIVLAIWTII 336 A ++N+ S + L N E+ L L+ TP+ + ++ +W+++ Sbjct: 911 AHNIKNFRSARWRALLNFNTENRLLLTGTPLQNNLMELWSLL 952
>VILI_DICDI (P36418) Protovillin (100 kDa actin-binding protein)| Length = 959 Score = 27.3 bits (59), Expect = 9.5 Identities = 8/21 (38%), Positives = 14/21 (66%) Frame = -1 Query: 339 DYYCPDCQDYMHDWSGGEIQR 277 D + DC+D+++ W+G E R Sbjct: 220 DVFVLDCEDFIYQWNGSESSR 240
>HOOK1_HUMAN (Q9UJC3) Hook homolog 1 (h-hook1) (hHK1)| Length = 728 Score = 27.3 bits (59), Expect = 9.5 Identities = 14/39 (35%), Positives = 24/39 (61%) Frame = +3 Query: 186 HLVKTQANGTRSKKLLLRWRGQLP*VEFRKLFVSLHHSN 302 HL +T A+ T+S + L ++ VE+R++F+ L H N Sbjct: 439 HLNQTDASATKSYENLA---AEIMPVEYREVFIRLQHEN 474
>SWR1_SCHPO (O13682) Helicase swr1 (EC 3.6.1.-)| Length = 1288 Score = 27.3 bits (59), Expect = 9.5 Identities = 12/42 (28%), Positives = 24/42 (57%) Frame = +1 Query: 211 APGVRNYFSGGEVSCLRLNFESSLYLSTTPIMHIVLAIWTII 336 A ++N+ S S L N E L L+ TP+ + ++ +W+++ Sbjct: 577 AHNIKNFRSQRWQSLLNFNAEHRLLLTGTPLQNNLVELWSLL 618
>MRAY_VIBF1 (Q5E2P7) Phospho-N-acetylmuramoyl-pentapeptide-transferase (EC| 2.7.8.13) (UDP-MurNAc-pentapeptide phosphotransferase) Length = 360 Score = 27.3 bits (59), Expect = 9.5 Identities = 11/31 (35%), Positives = 19/31 (61%) Frame = -1 Query: 120 FRCIIMSLKWTAVVVWMHPELLAYCRLLQFG 28 FR I+ + + +WM P+L+A+ + LQ G Sbjct: 24 FRAILSIITALTISLWMGPKLIAWLQNLQIG 54
>MRAY_SHISS (Q3Z5S2) Phospho-N-acetylmuramoyl-pentapeptide-transferase (EC| 2.7.8.13) (UDP-MurNAc-pentapeptide phosphotransferase) Length = 360 Score = 27.3 bits (59), Expect = 9.5 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = -1 Query: 120 FRCIIMSLKWTAVVVWMHPELLAYCRLLQFG 28 FR I+ L + +WM P ++A+ + L FG Sbjct: 24 FRAIVSLLTALFISLWMGPRMIAHLQKLSFG 54
>MRAY_SHIFL (P0A6W4) Phospho-N-acetylmuramoyl-pentapeptide-transferase (EC| 2.7.8.13) (UDP-MurNAc-pentapeptide phosphotransferase) Length = 360 Score = 27.3 bits (59), Expect = 9.5 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = -1 Query: 120 FRCIIMSLKWTAVVVWMHPELLAYCRLLQFG 28 FR I+ L + +WM P ++A+ + L FG Sbjct: 24 FRAIVSLLTALFISLWMGPRMIAHLQKLSFG 54
>MRAY_SHIDS (Q32K05) Phospho-N-acetylmuramoyl-pentapeptide-transferase (EC| 2.7.8.13) (UDP-MurNAc-pentapeptide phosphotransferase) Length = 360 Score = 27.3 bits (59), Expect = 9.5 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = -1 Query: 120 FRCIIMSLKWTAVVVWMHPELLAYCRLLQFG 28 FR I+ L + +WM P ++A+ + L FG Sbjct: 24 FRAIVSLLTALFISLWMGPRMIAHLQKLSFG 54
>MRAY_SHIBS (Q326E8) Phospho-N-acetylmuramoyl-pentapeptide-transferase (EC| 2.7.8.13) (UDP-MurNAc-pentapeptide phosphotransferase) Length = 360 Score = 27.3 bits (59), Expect = 9.5 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = -1 Query: 120 FRCIIMSLKWTAVVVWMHPELLAYCRLLQFG 28 FR I+ L + +WM P ++A+ + L FG Sbjct: 24 FRAIVSLLTALFISLWMGPRMIAHLQKLSFG 54
>MRAY_ECOLI (P0A6W3) Phospho-N-acetylmuramoyl-pentapeptide-transferase (EC| 2.7.8.13) (UDP-MurNAc-pentapeptide phosphotransferase) Length = 360 Score = 27.3 bits (59), Expect = 9.5 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = -1 Query: 120 FRCIIMSLKWTAVVVWMHPELLAYCRLLQFG 28 FR I+ L + +WM P ++A+ + L FG Sbjct: 24 FRAIVSLLTALFISLWMGPRMIAHLQKLSFG 54
>MRAY_ECOL6 (P64257) Phospho-N-acetylmuramoyl-pentapeptide-transferase (EC| 2.7.8.13) (UDP-MurNAc-pentapeptide phosphotransferase) Length = 360 Score = 27.3 bits (59), Expect = 9.5 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = -1 Query: 120 FRCIIMSLKWTAVVVWMHPELLAYCRLLQFG 28 FR I+ L + +WM P ++A+ + L FG Sbjct: 24 FRAIVSLLTALFISLWMGPRMIAHLQKLSFG 54
>MRAY_ECO57 (P64258) Phospho-N-acetylmuramoyl-pentapeptide-transferase (EC| 2.7.8.13) (UDP-MurNAc-pentapeptide phosphotransferase) Length = 360 Score = 27.3 bits (59), Expect = 9.5 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = -1 Query: 120 FRCIIMSLKWTAVVVWMHPELLAYCRLLQFG 28 FR I+ L + +WM P ++A+ + L FG Sbjct: 24 FRAIVSLLTALFISLWMGPRMIAHLQKLSFG 54 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 49,293,870 Number of Sequences: 219361 Number of extensions: 863524 Number of successful extensions: 2149 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 2120 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2149 length of database: 80,573,946 effective HSP length: 91 effective length of database: 60,612,095 effective search space used: 1454690280 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
