| Clone Name | rbags16f05 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | VPS41_LYCES (P93231) Vacuolar assembly protein VPS41 homolog | 28 | 9.6 |
|---|
>VPS41_LYCES (P93231) Vacuolar assembly protein VPS41 homolog| Length = 960 Score = 28.5 bits (62), Expect = 9.6 Identities = 14/39 (35%), Positives = 21/39 (53%) Frame = +3 Query: 90 VGFVAASPNVAFHSTRMASPKTFRRS*YSNTPQIPAISP 206 V VA + N +FH +++ K++ YS TP AI P Sbjct: 497 VALVALATNPSFHKDLLSTVKSWPPRIYSTTPVFSAIEP 535 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 42,266,324 Number of Sequences: 219361 Number of extensions: 652532 Number of successful extensions: 1362 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1353 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1362 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3246866728 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)