| Clone Name | rbags16e19 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ZDS_LYCES (Q9SE20) Zeta-carotene desaturase, chloroplast precurs... | 28 | 6.3 | 2 | RECO_CHLMU (Q9PJS3) DNA repair protein recO (Recombination prote... | 28 | 8.3 | 3 | ZDS_CAPAN (Q9SMJ3) Zeta-carotene desaturase, chloroplast precurs... | 28 | 8.3 |
|---|
>ZDS_LYCES (Q9SE20) Zeta-carotene desaturase, chloroplast precursor (EC| 1.14.99.30) (Carotene 7,8-desaturase) Length = 588 Score = 28.1 bits (61), Expect = 6.3 Identities = 15/54 (27%), Positives = 28/54 (51%), Gaps = 2/54 (3%) Frame = -2 Query: 162 EHTHSWV--GSSIFVAVFRYGI*VPINQLHLCRSLERLYYYKLXXQGLAVCITP 7 EHTH++V G I FR+ + P++ ++ S +L Y +A+ ++P Sbjct: 160 EHTHTFVNKGGEIGELDFRFPVGAPLHGINAFLSTNQLKIYDKARNAVALALSP 213
>RECO_CHLMU (Q9PJS3) DNA repair protein recO (Recombination protein O)| Length = 234 Score = 27.7 bits (60), Expect = 8.3 Identities = 13/36 (36%), Positives = 22/36 (61%) Frame = -2 Query: 231 WQCPKRPRPKATSLRLAYITNLPEHTHSWVGSSIFV 124 WQ ++P P+ SL L ++ +PE H + SS+F+ Sbjct: 103 WQ--EKPSPQLFSLFLNFLQRIPETPHPYFFSSMFL 136
>ZDS_CAPAN (Q9SMJ3) Zeta-carotene desaturase, chloroplast precursor (EC| 1.14.99.30) (Carotene 7,8-desaturase) Length = 588 Score = 27.7 bits (60), Expect = 8.3 Identities = 15/54 (27%), Positives = 28/54 (51%), Gaps = 2/54 (3%) Frame = -2 Query: 162 EHTHSWV--GSSIFVAVFRYGI*VPINQLHLCRSLERLYYYKLXXQGLAVCITP 7 EHTH++V G I FR+ + P++ ++ S +L Y +A+ ++P Sbjct: 160 EHTHTFVNKGGEIGELDFRFPVGAPLHGINAFLSTNQLKTYDKARNAVALALSP 213 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 35,212,392 Number of Sequences: 219361 Number of extensions: 585967 Number of successful extensions: 1208 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1193 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1208 length of database: 80,573,946 effective HSP length: 54 effective length of database: 68,728,452 effective search space used: 1649482848 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)