| Clone Name | rbags16d16 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SM3L3_ARATH (Q9FIY7) Putative SWI/SNF-related matrix-associated ... | 30 | 4.6 | 2 | E310_ADE07 (P15134) Early E3B 10.4 kDa protein precursor | 29 | 7.9 | 3 | E310_ADE03 (P11318) Early E3B 10.4 kDa protein precursor | 29 | 7.9 |
|---|
>SM3L3_ARATH (Q9FIY7) Putative SWI/SNF-related matrix-associated actin-dependent| regulator of chromatin subfamily A member 3-like 3 (EC 3.6.1.-) (SMARCA3-like protein 3) Length = 1277 Score = 30.0 bits (66), Expect = 4.6 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +2 Query: 116 SWSSPAVFTCPICRCLLSNCQITS 187 SW SP+ CPICR +L ++ S Sbjct: 1067 SWRSPSCGLCPICRTILKRTELIS 1090
>E310_ADE07 (P15134) Early E3B 10.4 kDa protein precursor| Length = 91 Score = 29.3 bits (64), Expect = 7.9 Identities = 16/63 (25%), Positives = 27/63 (42%) Frame = -3 Query: 377 FNVAVCKFWSCRQA*QPLLLSVLLFGPFSLIVDAGDLACISCVCTIICSYVPIVERCVYL 198 F + +C F C S GPF+ + CI CVC+I+C + + ++ Sbjct: 8 FTILICAFNVCATFTAVATASPDCIGPFASYALFAFVTCI-CVCSIVCLVINFFQLVDWI 66 Query: 197 VIR 189 +R Sbjct: 67 FVR 69
>E310_ADE03 (P11318) Early E3B 10.4 kDa protein precursor| Length = 91 Score = 29.3 bits (64), Expect = 7.9 Identities = 16/63 (25%), Positives = 27/63 (42%) Frame = -3 Query: 377 FNVAVCKFWSCRQA*QPLLLSVLLFGPFSLIVDAGDLACISCVCTIICSYVPIVERCVYL 198 F + +C F C S GPF+ + CI CVC+I+C + + ++ Sbjct: 8 FTILICPFNVCATFTAVATASPDCIGPFASYALFAFVTCI-CVCSIVCLVINFFQLVDWI 66 Query: 197 VIR 189 +R Sbjct: 67 FVR 69 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 65,568,123 Number of Sequences: 219361 Number of extensions: 1222992 Number of successful extensions: 2599 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2536 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2599 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4545742239 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)