| Clone Name | rbags16c24 |
|---|---|
| Clone Library Name | barley_pub |
>LTI6A_ORYSA (Q8H5T6) Hydrophobic protein LTI6A (Low temperature-induced protein| 6A) Length = 56 Score = 84.0 bits (206), Expect = 2e-16 Identities = 42/57 (73%), Positives = 42/57 (73%) Frame = -3 Query: 373 MADEGTANCXXXXXXXXXXXLGVFFKFACGIEFWICLLLTFFGYLPGIIYAVWVITK 203 MAD TA C LGVFFKF CGIEFWICLLLTFFGYLPGIIYAVWVITK Sbjct: 1 MADS-TATCIDIILAIILPPLGVFFKFGCGIEFWICLLLTFFGYLPGIIYAVWVITK 56
>LTI6B_ORYSA (Q6AT93) Hydrophobic protein LTI6B (Low temperature-induced protein| 6B) Length = 55 Score = 73.9 bits (180), Expect = 2e-13 Identities = 34/53 (64%), Positives = 37/53 (69%) Frame = -3 Query: 361 GTANCXXXXXXXXXXXLGVFFKFACGIEFWICLLLTFFGYLPGIIYAVWVITK 203 GTANC LGVF KF CG EFWICLLLTF GY+PGIIYA++ ITK Sbjct: 3 GTANCIDILIAIILPPLGVFLKFGCGHEFWICLLLTFLGYIPGIIYAIYAITK 55
>RCI2B_ARATH (Q9ZNS6) Hydrophobic protein RCI2B (Low temperature and| salt-responsive protein LTI6B) Length = 54 Score = 66.2 bits (160), Expect = 4e-11 Identities = 26/36 (72%), Positives = 32/36 (88%) Frame = -3 Query: 310 GVFFKFACGIEFWICLLLTFFGYLPGIIYAVWVITK 203 GVF KF C +EFWICL+LT FGYLPGI+YA+++ITK Sbjct: 19 GVFLKFGCKVEFWICLILTLFGYLPGILYALYIITK 54
>RCI2A_ARATH (Q9ZNQ7) Hydrophobic protein RCI2A (Low temperature and| salt-responsive protein LTI6A) Length = 54 Score = 65.9 bits (159), Expect = 5e-11 Identities = 25/36 (69%), Positives = 32/36 (88%) Frame = -3 Query: 310 GVFFKFACGIEFWICLLLTFFGYLPGIIYAVWVITK 203 GVF +F CG+EFWICL+LT GY+PGIIYA++V+TK Sbjct: 19 GVFLRFGCGVEFWICLVLTLLGYIPGIIYAIYVLTK 54
>RC21_ARATH (Q9FE70) Hypothetical UPF0057 protein At1g57550| Length = 52 Score = 58.9 bits (141), Expect = 6e-09 Identities = 21/36 (58%), Positives = 31/36 (86%) Frame = -3 Query: 310 GVFFKFACGIEFWICLLLTFFGYLPGIIYAVWVITK 203 GVF ++ G+EFW+CLLLT F ++PG+IYA++V+TK Sbjct: 17 GVFLRYGLGLEFWVCLLLTLFAFIPGLIYAIYVLTK 52
>LT01_HORVU (P68179) Low temperature-induced protein lt101.1 (Blt101)| (Blt101.1) Length = 54 Score = 58.2 bits (139), Expect = 1e-08 Identities = 23/34 (67%), Positives = 29/34 (85%) Frame = -3 Query: 310 GVFFKFACGIEFWICLLLTFFGYLPGIIYAVWVI 209 GVF ++ G+EFWICLLLT GY+PGIIYAV+V+ Sbjct: 19 GVFLRYKLGVEFWICLLLTILGYIPGIIYAVYVL 52
>ESI3_LOPEL (P68178) Salt stress-induced hydrophobic peptide ESI3| Length = 54 Score = 58.2 bits (139), Expect = 1e-08 Identities = 23/34 (67%), Positives = 29/34 (85%) Frame = -3 Query: 310 GVFFKFACGIEFWICLLLTFFGYLPGIIYAVWVI 209 GVF ++ G+EFWICLLLT GY+PGIIYAV+V+ Sbjct: 19 GVFLRYKLGVEFWICLLLTILGYIPGIIYAVYVL 52
>LT02_HORVU (Q9ARD5) Low temperature-induced protein lt101.2| Length = 54 Score = 56.2 bits (134), Expect = 4e-08 Identities = 22/34 (64%), Positives = 28/34 (82%) Frame = -3 Query: 310 GVFFKFACGIEFWICLLLTFFGYLPGIIYAVWVI 209 GVF ++ +EFWICLLLT GY+PGIIYAV+V+ Sbjct: 19 GVFLRYGLAVEFWICLLLTLLGYIPGIIYAVYVL 52
>OSR8_ORYSA (Q9LRI7) Hydrophobic protein OSR8| Length = 72 Score = 50.4 bits (119), Expect = 2e-06 Identities = 23/35 (65%), Positives = 28/35 (80%), Gaps = 1/35 (2%) Frame = -3 Query: 310 GVFFKFAC-GIEFWICLLLTFFGYLPGIIYAVWVI 209 GVF +F C +EF ICLLLT GY+PGIIYAV+V+ Sbjct: 22 GVFLRFGCCSMEFCICLLLTILGYVPGIIYAVYVL 56
>RC24_ARATH (Q9SUI0) Hypothetical UPF0057 protein At4g30660| Length = 74 Score = 47.0 bits (110), Expect = 2e-05 Identities = 20/32 (62%), Positives = 25/32 (78%) Frame = -3 Query: 304 FFKFACGIEFWICLLLTFFGYLPGIIYAVWVI 209 F K C +EF ICL+LT GY+PGIIYA++VI Sbjct: 24 FRKGCCTVEFLICLVLTILGYVPGIIYAIYVI 55
>RC22_ARATH (O82232) Hypothetical UPF0057 protein At2g24040| Length = 75 Score = 45.4 bits (106), Expect = 7e-05 Identities = 18/27 (66%), Positives = 23/27 (85%) Frame = -3 Query: 289 CGIEFWICLLLTFFGYLPGIIYAVWVI 209 C +EF+ICL+LT GYLPGIIYA++ I Sbjct: 29 CTVEFFICLILTCLGYLPGIIYAIYAI 55
>Y567_PSEAE (Q9I5W9) Hypothetical UPF0057 protein PA0567| Length = 52 Score = 45.1 bits (105), Expect = 9e-05 Identities = 18/36 (50%), Positives = 26/36 (72%) Frame = -3 Query: 310 GVFFKFACGIEFWICLLLTFFGYLPGIIYAVWVITK 203 GVF + G FW+ +LLT GY+PGI++AV++I K Sbjct: 16 GVFLQVGFGGAFWLNILLTLLGYIPGIVHAVYIIAK 51
>RC23_ARATH (Q9M095) Hypothetical UPF0057 protein At4g30650| Length = 73 Score = 44.7 bits (104), Expect = 1e-04 Identities = 18/27 (66%), Positives = 23/27 (85%) Frame = -3 Query: 289 CGIEFWICLLLTFFGYLPGIIYAVWVI 209 C +EF ICL+LT GY+PGIIYA++VI Sbjct: 29 CTVEFLICLVLTILGYIPGIIYALYVI 55
>YCU3_CAEEL (Q22700) Hypothetical UPF0057 protein T23F2.3 in chromosome X| Length = 57 Score = 43.9 bits (102), Expect = 2e-04 Identities = 19/34 (55%), Positives = 23/34 (67%) Frame = -3 Query: 310 GVFFKFACGIEFWICLLLTFFGYLPGIIYAVWVI 209 GVF + C IC+LLT GY+PGIIYA +VI Sbjct: 21 GVFLEKGCDYHLAICILLTILGYIPGIIYACYVI 54
>Y1169_SYNY3 (P74805) Hypothetical UPF0057 protein ssr1169| Length = 54 Score = 43.9 bits (102), Expect = 2e-04 Identities = 19/37 (51%), Positives = 27/37 (72%), Gaps = 1/37 (2%) Frame = -3 Query: 310 GVFFKFACGIEFWICLLLTFFG-YLPGIIYAVWVITK 203 GVF + G +FWI LLLT FG Y+ G+++A+WVI + Sbjct: 16 GVFLQVGIGKDFWINLLLTIFGLYILGLVHAIWVIAR 52
>YCU4_CAEEL (Q22701) Hypothetical UPF0057 protein T23F2.4 in chromosome X| Length = 57 Score = 42.4 bits (98), Expect = 6e-04 Identities = 18/34 (52%), Positives = 23/34 (67%) Frame = -3 Query: 310 GVFFKFACGIEFWICLLLTFFGYLPGIIYAVWVI 209 GVF + C IC+LLT GY+PGIIYA ++I Sbjct: 21 GVFLEKGCTHHLAICILLTILGYIPGIIYACYII 54
>RIC1_PHYIN (Q9Y068) Protein Ric1| Length = 57 Score = 40.4 bits (93), Expect = 0.002 Identities = 17/36 (47%), Positives = 25/36 (69%) Frame = -3 Query: 310 GVFFKFACGIEFWICLLLTFFGYLPGIIYAVWVITK 203 GVFF+ C + I LLT GY+PG+I+AV+++ K Sbjct: 21 GVFFQVGCTKDLAINCLLTVLGYIPGVIHAVYILIK 56
>YQAE_ECOLI (P0AE42) Hypothetical UPF0057 protein yqaE| Length = 52 Score = 36.2 bits (82), Expect = 0.043 Identities = 17/36 (47%), Positives = 22/36 (61%) Frame = -3 Query: 310 GVFFKFACGIEFWICLLLTFFGYLPGIIYAVWVITK 203 GV G F I +LLT GY+PG+I+A WV T+ Sbjct: 16 GVLLGKGFGWAFIINILLTLLGYIPGLIHAFWVQTR 51
>YQAE_ECOL6 (P0AE43) Hypothetical UPF0057 protein yqaE| Length = 52 Score = 36.2 bits (82), Expect = 0.043 Identities = 17/36 (47%), Positives = 22/36 (61%) Frame = -3 Query: 310 GVFFKFACGIEFWICLLLTFFGYLPGIIYAVWVITK 203 GV G F I +LLT GY+PG+I+A WV T+ Sbjct: 16 GVLLGKGFGWAFIINILLTLLGYIPGLIHAFWVQTR 51
>YQAE_ECO57 (P0AE44) Hypothetical UPF0057 protein yqaE| Length = 52 Score = 36.2 bits (82), Expect = 0.043 Identities = 17/36 (47%), Positives = 22/36 (61%) Frame = -3 Query: 310 GVFFKFACGIEFWICLLLTFFGYLPGIIYAVWVITK 203 GV G F I +LLT GY+PG+I+A WV T+ Sbjct: 16 GVLLGKGFGWAFIINILLTLLGYIPGLIHAFWVQTR 51
>YCU5_CAEEL (Q22702) Hypothetical UPF0057 protein T23F2.5 in chromosome X| Length = 57 Score = 35.0 bits (79), Expect = 0.095 Identities = 16/34 (47%), Positives = 22/34 (64%) Frame = -3 Query: 310 GVFFKFACGIEFWICLLLTFFGYLPGIIYAVWVI 209 GV+ + C I +LLT GY+PGII+A +VI Sbjct: 21 GVWLEKGCTYHLAINILLTILGYIPGIIHACYVI 54
>SNA4_YEAST (Q07549) Protein SNA4| Length = 140 Score = 32.7 bits (73), Expect = 0.47 Identities = 14/33 (42%), Positives = 22/33 (66%) Frame = -3 Query: 289 CGIEFWICLLLTFFGYLPGIIYAVWVITK*PPL 191 C +F + +LLT G+LPG+++A + IT PL Sbjct: 34 CSSDFLLNVLLTLLGFLPGMLHAFYYITITSPL 66
>YOT0_CAEEL (P34655) Hypothetical UPF0057 protein ZK632.10 in chromosome III| Length = 80 Score = 29.3 bits (64), Expect = 5.2 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = -3 Query: 307 VFFKFACGIEFWICLLLTFFGYLPGIIYAVWVI 209 V C + I +LLT G +PGII+A ++I Sbjct: 18 VLLDVGCNCDLLINILLTCLGIIPGIIHAWYII 50
>HOMEZ_MOUSE (Q80W88) Homeobox and leucine zipper protein Homez (Homeodomain| leucine zipper-containing factor) Length = 518 Score = 29.3 bits (64), Expect = 5.2 Identities = 13/25 (52%), Positives = 16/25 (64%) Frame = +2 Query: 269 DPELDPAGELEEDAERRQDDGEDDV 343 + EL GE EE+ E DDG+DDV Sbjct: 490 EDELPEDGEEEEEEEEDDDDGDDDV 514 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 40,691,332 Number of Sequences: 219361 Number of extensions: 674437 Number of successful extensions: 2467 Number of sequences better than 10.0: 24 Number of HSP's better than 10.0 without gapping: 2205 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2431 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 3026354448 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)