ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbags16c15 |
|---|---|
| Clone Library Name | barley_pub |
>UBP3_ARATH (O24454) Ubiquitin carboxyl-terminal hydrolase 3 (EC 3.1.2.15)| (Ubiquitin thioesterase 3) (Ubiquitin-specific-processing protease 3) (Deubiquitinating enzyme 3) (AtUBP3) Length = 371 Score = 119 bits (298), Expect = 5e-27 Identities = 53/66 (80%), Positives = 59/66 (89%) Frame = -1 Query: 502 VHVGSGPNXGHYISVVKSHNHWLFFDDETVEMTDESMVQTFFGSAQEFSGNTDNGYILFY 323 VHVGSGPN GHY+S+VKSHNHWLFFDDE VEM +ES VQTFFGS+QE+S NTD+GYILFY Sbjct: 305 VHVGSGPNHGHYVSLVKSHNHWLFFDDENVEMIEESAVQTFFGSSQEYSSNTDHGYILFY 364 Query: 322 ESLAKT 305 ESL T Sbjct: 365 ESLGPT 370
>UBP4_ARATH (Q8LAM0) Ubiquitin carboxyl-terminal hydrolase 4 (EC 3.1.2.15)| (Ubiquitin thioesterase 4) (Ubiquitin-specific-processing protease 4) (Deubiquitinating enzyme 4) (AtUBP4) Length = 365 Score = 114 bits (285), Expect = 1e-25 Identities = 50/63 (79%), Positives = 58/63 (92%) Frame = -1 Query: 502 VHVGSGPNXGHYISVVKSHNHWLFFDDETVEMTDESMVQTFFGSAQEFSGNTDNGYILFY 323 VHVGSGPN GHY+S+VKSHNHWLFFDDE+VE+ +ES VQTFFGS+QE+S NTD+GYIL Y Sbjct: 300 VHVGSGPNHGHYVSLVKSHNHWLFFDDESVEIIEESAVQTFFGSSQEYSSNTDHGYILLY 359 Query: 322 ESL 314 ESL Sbjct: 360 ESL 362
>UBP12_HUMAN (O75317) Ubiquitin carboxyl-terminal hydrolase 12 (EC 3.1.2.15)| (Ubiquitin thioesterase 12) (Ubiquitin-specific-processing protease 12) (Deubiquitinating enzyme 12) (Ubiquitin hydrolyzing enzyme 1) Length = 355 Score = 83.6 bits (205), Expect = 3e-16 Identities = 34/62 (54%), Positives = 46/62 (74%) Frame = -1 Query: 502 VHVGSGPNXGHYISVVKSHNHWLFFDDETVEMTDESMVQTFFGSAQEFSGNTDNGYILFY 323 VH GSGPN GHYI++VKSH+ WL FDD+ VE D ++ F+G + S N+++GYILFY Sbjct: 292 VHCGSGPNRGHYIAIVKSHDFWLLFDDDIVEKIDAQAIEEFYGLTSDISKNSESGYILFY 351 Query: 322 ES 317 +S Sbjct: 352 QS 353
>UBP46_MOUSE (P62069) Ubiquitin carboxyl-terminal hydrolase 46 (EC 3.1.2.15)| (Ubiquitin thioesterase 46) (Ubiquitin-specific-processing protease 46) (Deubiquitinating enzyme 46) Length = 366 Score = 83.2 bits (204), Expect = 4e-16 Identities = 34/62 (54%), Positives = 45/62 (72%) Frame = -1 Query: 502 VHVGSGPNXGHYISVVKSHNHWLFFDDETVEMTDESMVQTFFGSAQEFSGNTDNGYILFY 323 VH GSGPN GHYI++VKSH WL FDD+ VE D ++ F+G + S N+++GYILFY Sbjct: 303 VHCGSGPNRGHYITIVKSHGFWLLFDDDIVEKIDAQAIEEFYGLTSDISKNSESGYILFY 362 Query: 322 ES 317 +S Sbjct: 363 QS 364
>UBP46_HUMAN (P62068) Ubiquitin carboxyl-terminal hydrolase 46 (EC 3.1.2.15)| (Ubiquitin thioesterase 46) (Ubiquitin-specific-processing protease 46) (Deubiquitinating enzyme 46) Length = 366 Score = 83.2 bits (204), Expect = 4e-16 Identities = 34/62 (54%), Positives = 45/62 (72%) Frame = -1 Query: 502 VHVGSGPNXGHYISVVKSHNHWLFFDDETVEMTDESMVQTFFGSAQEFSGNTDNGYILFY 323 VH GSGPN GHYI++VKSH WL FDD+ VE D ++ F+G + S N+++GYILFY Sbjct: 303 VHCGSGPNRGHYITIVKSHGFWLLFDDDIVEKIDAQAIEEFYGLTSDISKNSESGYILFY 362 Query: 322 ES 317 +S Sbjct: 363 QS 364
>UBP9_SCHPO (Q9P7V9) Probable ubiquitin carboxyl-terminal hydrolase 9 (EC| 3.1.2.15) (Ubiquitin thioesterase 9) (Ubiquitin-specific processing protease 9) (Deubiquitinating enzyme 9) Length = 585 Score = 56.2 bits (134), Expect = 5e-08 Identities = 26/61 (42%), Positives = 37/61 (60%), Gaps = 1/61 (1%) Frame = -1 Query: 502 VHVGSGPNXGHYISVVKSHNH-WLFFDDETVEMTDESMVQTFFGSAQEFSGNTDNGYILF 326 VHVG GP+ GHY+S+V++ + W+ FDDE V +E+ +Q FFG Y+LF Sbjct: 365 VHVGGGPHRGHYVSIVRTKTYGWVLFDDENVTPVNENYLQRFFGD----QPGQATAYVLF 420 Query: 325 Y 323 Y Sbjct: 421 Y 421
>UBP9_YEAST (P39967) Ubiquitin carboxyl-terminal hydrolase 9 (EC 3.1.2.15)| (Ubiquitin thioesterase 9) (Ubiquitin-specific-processing protease 9) (Deubiquitinating enzyme 9) Length = 754 Score = 53.1 bits (126), Expect = 4e-07 Identities = 25/62 (40%), Positives = 35/62 (56%), Gaps = 1/62 (1%) Frame = -1 Query: 502 VHVGSGPNXGHYISVVKSHNH-WLFFDDETVEMTDESMVQTFFGSAQEFSGNTDNGYILF 326 +H+GSGP GHY+ + ++ WL +DDETVE E V F G G+ Y+LF Sbjct: 608 IHMGSGPQHGHYVCICRNEKFGWLLYDDETVESIKEETVLQFTG----HPGDQTTAYVLF 663 Query: 325 YE 320 Y+ Sbjct: 664 YK 665
>UBPX_CAEEL (P34547) Probable ubiquitin carboxyl-terminal hydrolase R10E11.3| (EC 3.1.2.15) (Ubiquitin thioesterase) (Ubiquitin-specific processing protease) (Deubiquitinating enzyme) Length = 410 Score = 52.8 bits (125), Expect = 5e-07 Identities = 22/47 (46%), Positives = 33/47 (70%) Frame = -1 Query: 502 VHVGSGPNXGHYISVVKSHNHWLFFDDETVEMTDESMVQTFFGSAQE 362 VH G+ PN GHYI++VKS++ WL FDD+ VE + S ++ F G + + Sbjct: 332 VHCGATPNRGHYITLVKSNSFWLVFDDDIVEKLEVSSMEEFSGMSTD 378
>UBP13_YEAST (P38187) Ubiquitin carboxyl-terminal hydrolase 13 (EC 3.1.2.15)| (Ubiquitin thioesterase 13) (Ubiquitin-specific-processing protease 13) (Deubiquitinating enzyme 13) Length = 688 Score = 52.0 bits (123), Expect = 9e-07 Identities = 28/67 (41%), Positives = 34/67 (50%), Gaps = 1/67 (1%) Frame = -1 Query: 502 VHVGSGPNXGHYISVVKSHNH-WLFFDDETVEMTDESMVQTFFGSAQEFSGNTDNGYILF 326 VH+G GP GHY+S+ K WL FDDETVE E V F G S N Y+ F Sbjct: 609 VHMGGGPQHGHYVSLCKHEKFGWLLFDDETVEAVKEETVLEFTGE----SPNMATAYVCF 664 Query: 325 YESLAKT 305 + +T Sbjct: 665 IKRCIQT 671
>UBP3_MOUSE (Q91W36) Ubiquitin carboxyl-terminal hydrolase 3 (EC 3.1.2.15)| (Ubiquitin thioesterase 3) (Ubiquitin-specific-processing protease 3) (Deubiquitinating enzyme 3) Length = 520 Score = 41.6 bits (96), Expect = 0.001 Identities = 24/60 (40%), Positives = 28/60 (46%) Frame = -1 Query: 502 VHVGSGPNXGHYISVVKSHNHWLFFDDETVEMTDESMVQTFFGSAQEFSGNTDNGYILFY 323 VH GSG GHY + W F+D TV +TDE V G A+ YILFY Sbjct: 461 VHHGSGVGSGHYTAYAVHEGRWFHFNDSTVTVTDEETV----GKAK--------AYILFY 508
>UBP3_HUMAN (Q9Y6I4) Ubiquitin carboxyl-terminal hydrolase 3 (EC 3.1.2.15)| (Ubiquitin thioesterase 3) (Ubiquitin-specific-processing protease 3) (Deubiquitinating enzyme 3) Length = 521 Score = 40.4 bits (93), Expect = 0.003 Identities = 17/38 (44%), Positives = 20/38 (52%) Frame = -1 Query: 502 VHVGSGPNXGHYISVVKSHNHWLFFDDETVEMTDESMV 389 VH GSG GHY + W F+D TV +TDE V Sbjct: 462 VHHGSGVGSGHYTAYATHEGRWFHFNDSTVTLTDEETV 499
>UBP29_MOUSE (Q9ES63) Ubiquitin carboxyl-terminal hydrolase 29 (EC 3.1.2.15)| (Ubiquitin thioesterase 29) (Ubiquitin-specific-processing protease 29) (Deubiquitinating enzyme 29) Length = 869 Score = 37.0 bits (84), Expect = 0.030 Identities = 25/77 (32%), Positives = 32/77 (41%), Gaps = 9/77 (11%) Frame = -1 Query: 499 HVGSGPNXGHYISVVKSHNH--WLFFDDETVEMTDESMVQTFFGSAQEFSGNTDNGYILF 326 H GS PN GHY+S V WL + D V + + +Q ++GYI F Sbjct: 772 HFGSSPNSGHYVSDVYDFQKQAWLLYSDVQVFESSDPSIQ---------ENRLNSGYIFF 822 Query: 325 Y-------ESLAKTS*C 296 Y E L K S C Sbjct: 823 YMHNEIFEELLKKASEC 839
>UBP6_SCHPO (Q92353) Ubiquitin carboxyl-terminal hydrolase 6 (EC 3.1.2.15)| (Ubiquitin thiolesterase 6) (Ubiquitin-specific processing protease 6) (Deubiquitinating enzyme 6) Length = 467 Score = 37.0 bits (84), Expect = 0.030 Identities = 18/64 (28%), Positives = 32/64 (50%), Gaps = 3/64 (4%) Frame = -1 Query: 499 HVGSGPNXGHYISVVKSHNH---WLFFDDETVEMTDESMVQTFFGSAQEFSGNTDNGYIL 329 H G+ + GHY + +++ N+ W F+D V + ++T G G D+ YIL Sbjct: 405 HAGASASSGHYQAWIRNSNNRAEWFRFNDAKVSIVPAEKIETLDG-----GGEADSAYIL 459 Query: 328 FYES 317 Y++ Sbjct: 460 LYKA 463
>UBP26_MOUSE (Q99MX1) Ubiquitin carboxyl-terminal hydrolase 26 (EC 3.1.2.15)| (Ubiquitin thioesterase 26) (Ubiquitin-specific-processing protease 26) (Deubiquitinating enzyme 26) Length = 835 Score = 36.6 bits (83), Expect = 0.039 Identities = 19/61 (31%), Positives = 26/61 (42%), Gaps = 2/61 (3%) Frame = -1 Query: 499 HVGSGPNXGHYISVV--KSHNHWLFFDDETVEMTDESMVQTFFGSAQEFSGNTDNGYILF 326 H+G+ PN GHYI+ W + D V T E V + G + GY+ F Sbjct: 762 HIGNSPNGGHYINDAFDFKRQSWFTYSDLHVTRTQEDFV---------YRGRSSTGYVFF 812 Query: 325 Y 323 Y Sbjct: 813 Y 813
>UBP29_HUMAN (Q9HBJ7) Ubiquitin carboxyl-terminal hydrolase 29 (EC 3.1.2.15)| (Ubiquitin thioesterase 29) (Ubiquitin-specific-processing protease 29) (Deubiquitinating enzyme 29) Length = 922 Score = 36.6 bits (83), Expect = 0.039 Identities = 21/61 (34%), Positives = 27/61 (44%), Gaps = 2/61 (3%) Frame = -1 Query: 499 HVGSGPNXGHYISVVKSHNH--WLFFDDETVEMTDESMVQTFFGSAQEFSGNTDNGYILF 326 H+GS PN GHYIS V W ++D V E+ +Q +GYI F Sbjct: 831 HIGSSPNSGHYISDVYDFQKQAWFTYNDLCVSEISETKMQ---------EARLHSGYIFF 881 Query: 325 Y 323 Y Sbjct: 882 Y 882
>UBPA_DICDI (P54201) Ubiquitin carboxyl-terminal hydrolase A (EC 3.1.2.15)| (Ubiquitin thioesterase A) (Ubiquitin-specific-processing protease A) (Deubiquitinating enzyme A) Length = 837 Score = 36.2 bits (82), Expect = 0.051 Identities = 16/60 (26%), Positives = 30/60 (50%) Frame = -1 Query: 499 HVGSGPNXGHYISVVKSHNHWLFFDDETVEMTDESMVQTFFGSAQEFSGNTDNGYILFYE 320 H+G+ GHY+ +K +N W+ F+D V+++++ + GYI FY+ Sbjct: 788 HLGNNVTCGHYVCHIKKNNRWIKFNDRHVQLSEQPPKEL--------------GYIYFYK 833
>UBP14_RABIT (P40826) Ubiquitin carboxyl-terminal hydrolase 14 (EC 3.1.2.15)| (Ubiquitin thioesterase 14) (Ubiquitin-specific-processing protease 14) (Deubiquitinating enzyme 14) Length = 492 Score = 35.8 bits (81), Expect = 0.066 Identities = 19/60 (31%), Positives = 28/60 (46%), Gaps = 1/60 (1%) Frame = -1 Query: 499 HVGSGPNXGHYISVVK-SHNHWLFFDDETVEMTDESMVQTFFGSAQEFSGNTDNGYILFY 323 H G + GHY+S VK H+ W+ FDD+ V + + G G+ Y+L Y Sbjct: 424 HQGRSSSSGHYVSWVKRKHDEWIKFDDDKVSIVTPEDILRLSG-----GGDWHIAYVLLY 478
>UBP6_YEAST (P43593) Ubiquitin carboxyl-terminal hydrolase 6 (EC 3.1.2.15)| (Ubiquitin thioesterase 6) (Ubiquitin-specific-processing protease 6) (Deubiquitinating enzyme 6) Length = 499 Score = 34.3 bits (77), Expect = 0.19 Identities = 16/63 (25%), Positives = 31/63 (49%), Gaps = 3/63 (4%) Frame = -1 Query: 499 HVGSGPNXGHYISVVKSH---NHWLFFDDETVEMTDESMVQTFFGSAQEFSGNTDNGYIL 329 H G+ GHY + ++ N W F+D+ V + ++ +++ G G +D+ IL Sbjct: 438 HQGANSESGHYQAFIRDELDENKWYKFNDDKVSVVEKEKIESLAG-----GGESDSALIL 492 Query: 328 FYE 320 Y+ Sbjct: 493 MYK 495
>UBP1_HUMAN (O94782) Ubiquitin carboxyl-terminal hydrolase 1 (EC 3.1.2.15)| (Ubiquitin thioesterase 1) (Ubiquitin-specific processing protease 1) (Deubiquitinating enzyme 1) (hUBP) Length = 785 Score = 33.9 bits (76), Expect = 0.25 Identities = 17/50 (34%), Positives = 26/50 (52%) Frame = -1 Query: 463 SVVKSHNHWLFFDDETVEMTDESMVQTFFGSAQEFSGNTDNGYILFYESL 314 S+ + WL FDD V++T+E + F S + T Y+LFY+ L Sbjct: 739 SLKEYEGKWLLFDDSEVKVTEE---KDFLNSLSPSTSPTSTPYLLFYKKL 785
>UBPE_DROME (Q24574) Ubiquitin carboxyl-terminal hydrolase 64E (EC 3.1.2.15)| (Ubiquitin thioesterase 64E) (Ubiquitin-specific-processing protease 64E) (Deubiquitinating enzyme 64E) Length = 1556 Score = 33.9 bits (76), Expect = 0.25 Identities = 20/71 (28%), Positives = 35/71 (49%), Gaps = 8/71 (11%) Frame = -1 Query: 502 VHVGSGPNXGHYISVVKS--HNHWLFFDDETVEMTDESMVQTFFGS------AQEFSGNT 347 +H GS + GHY + +K +N W F+D+ V + +Q FG + ++ +T Sbjct: 711 IHSGSA-SGGHYYAYIKDFDNNEWFCFNDQNVTSITQEDIQRSFGGPNGSYYSSAYTSST 769 Query: 346 DNGYILFYESL 314 N Y+L Y + Sbjct: 770 -NAYMLMYRQV 779
>UBP5_HUMAN (P45974) Ubiquitin carboxyl-terminal hydrolase 5 (EC 3.1.2.15)| (Ubiquitin thioesterase 5) (Ubiquitin-specific-processing protease 5) (Deubiquitinating enzyme 5) (Isopeptidase T) Length = 858 Score = 33.1 bits (74), Expect = 0.43 Identities = 16/63 (25%), Positives = 29/63 (46%) Frame = -1 Query: 499 HVGSGPNXGHYISVVKSHNHWLFFDDETVEMTDESMVQTFFGSAQEFSGNTDNGYILFYE 320 H+G+ GHY+ +K W+ ++D+ V +++ D GYI FY+ Sbjct: 809 HMGTSTMCGHYVCHIKKEGRWVIYNDQKVCASEKP--------------PKDLGYIYFYQ 854 Query: 319 SLA 311 +A Sbjct: 855 RVA 857
>UBPW_MOUSE (Q61068) Ubiquitin carboxyl-terminal hydrolase DUB-1 (EC 3.1.2.15)| (Ubiquitin thioesterase DUB-1) (Ubiquitin-specific processing protease DUB-1) (Deubiquitinating enzyme 1) Length = 526 Score = 33.1 bits (74), Expect = 0.43 Identities = 20/61 (32%), Positives = 26/61 (42%), Gaps = 1/61 (1%) Frame = -1 Query: 502 VHVGSGPNXGHYISVVKS-HNHWLFFDDETVEMTDESMVQTFFGSAQEFSGNTDNGYILF 326 VH G+ + GHY VK+ H W DD V D + V +N Y+LF Sbjct: 297 VHDGATSHSGHYFCCVKAGHGKWYKMDDTKVTRCDVTSVL------------NENAYVLF 344 Query: 325 Y 323 Y Sbjct: 345 Y 345
>UBP1_YEAST (P25037) Ubiquitin carboxyl-terminal hydrolase 1 (EC 3.1.2.15)| (Ubiquitin thioesterase 1) (Ubiquitin-specific-processing protease 1) (Deubiquitinating enzyme 1) Length = 809 Score = 33.1 bits (74), Expect = 0.43 Identities = 22/61 (36%), Positives = 29/61 (47%) Frame = -1 Query: 502 VHVGSGPNXGHYISVVKSHNHWLFFDDETVEMTDESMVQTFFGSAQEFSGNTDNGYILFY 323 VH G+ N GHYI+ K W DETV + DE+ V +T ++LFY Sbjct: 688 VHYGTH-NYGHYIAFRKYRGCWWRISDETVYVVDEAEVL-----------STPGVFMLFY 735 Query: 322 E 320 E Sbjct: 736 E 736
>UBP14_PANTR (P60051) Ubiquitin carboxyl-terminal hydrolase 14 (EC 3.1.2.15)| (Ubiquitin thioesterase 14) (Ubiquitin-specific-processing protease 14) (Deubiquitinating enzyme 14) Length = 492 Score = 32.7 bits (73), Expect = 0.56 Identities = 18/60 (30%), Positives = 27/60 (45%), Gaps = 1/60 (1%) Frame = -1 Query: 499 HVGSGPNXGHYISVVK-SHNHWLFFDDETVEMTDESMVQTFFGSAQEFSGNTDNGYILFY 323 H G + GHY+S VK + W+ FDD+ V + + G G+ Y+L Y Sbjct: 425 HQGRSSSSGHYVSWVKRKQDEWIKFDDDKVSIVTPEDILRLSG-----GGDWHIAYVLLY 479
>UBP14_HUMAN (P54578) Ubiquitin carboxyl-terminal hydrolase 14 (EC 3.1.2.15)| (Ubiquitin thioesterase 14) (Ubiquitin-specific-processing protease 14) (Deubiquitinating enzyme 14) Length = 493 Score = 32.7 bits (73), Expect = 0.56 Identities = 18/60 (30%), Positives = 27/60 (45%), Gaps = 1/60 (1%) Frame = -1 Query: 499 HVGSGPNXGHYISVVK-SHNHWLFFDDETVEMTDESMVQTFFGSAQEFSGNTDNGYILFY 323 H G + GHY+S VK + W+ FDD+ V + + G G+ Y+L Y Sbjct: 425 HQGRSSSSGHYVSWVKRKQDEWIKFDDDKVSIVTPEDILRLSG-----GGDWHIAYVLLY 479
>UBP37_HUMAN (Q86T82) Ubiquitin carboxyl-terminal hydrolase 37 (EC 3.1.2.15)| (Ubiquitin thioesterase 37) (Ubiquitin-specific-processing protease 37) (Deubiquitinating enzyme 37) Length = 979 Score = 32.7 bits (73), Expect = 0.56 Identities = 21/61 (34%), Positives = 27/61 (44%), Gaps = 2/61 (3%) Frame = -1 Query: 499 HVGSGPNXGHYISVVK--SHNHWLFFDDETVEMTDESMVQTFFGSAQEFSGNTDNGYILF 326 H+GS + GHYIS V W ++D V E+ VQ S +GYI F Sbjct: 897 HIGSTSSSGHYISDVYDIKKQAWFTYNDLEVSKIQEAAVQ---------SDRDRSGYIFF 947 Query: 325 Y 323 Y Sbjct: 948 Y 948
>UBP14_ARATH (Q8L6Y1) Ubiquitin carboxyl-terminal hydrolase 14 (EC 3.1.2.15)| (Ubiquitin thioesterase 14) (Ubiquitin-specific-processing protease 14) (Deubiquitinating enzyme 14) (AtUBP14) (TITAN-6 protein) Length = 797 Score = 32.0 bits (71), Expect = 0.95 Identities = 14/62 (22%), Positives = 29/62 (46%) Frame = -1 Query: 499 HVGSGPNXGHYISVVKSHNHWLFFDDETVEMTDESMVQTFFGSAQEFSGNTDNGYILFYE 320 H+G+ + GHY++ + W+ F+D+ V ++ + D GY+ F++ Sbjct: 749 HMGTSVHCGHYVAHILKEGRWVIFNDDKVGISTDP--------------PKDMGYVYFFQ 794 Query: 319 SL 314 L Sbjct: 795 RL 796
>UBP4_SCHPO (O60139) Probable ubiquitin carboxyl-terminal hydrolase 4 (EC| 3.1.2.15) (Ubiquitin thioesterase 4) (Ubiquitin-specific processing protease 4) (Deubiquitinating enzyme 4) Length = 438 Score = 32.0 bits (71), Expect = 0.95 Identities = 22/60 (36%), Positives = 29/60 (48%) Frame = -1 Query: 499 HVGSGPNXGHYISVVKSHNHWLFFDDETVEMTDESMVQTFFGSAQEFSGNTDNGYILFYE 320 H G N GHYIS V +N W DD S+V+T G + + + YILFY+ Sbjct: 367 HYGQLEN-GHYISDVLFNNEWCHIDD--------SIVRT-VGGITDLREDFSSSYILFYK 416
>UBP14_MOUSE (Q9JMA1) Ubiquitin carboxyl-terminal hydrolase 14 (EC 3.1.2.15)| (Ubiquitin thioesterase 14) (Ubiquitin-specific-processing protease 14) (Deubiquitinating enzyme 14) Length = 492 Score = 31.6 bits (70), Expect = 1.2 Identities = 17/60 (28%), Positives = 27/60 (45%), Gaps = 1/60 (1%) Frame = -1 Query: 499 HVGSGPNXGHYIS-VVKSHNHWLFFDDETVEMTDESMVQTFFGSAQEFSGNTDNGYILFY 323 H G + GHY+S V + + W+ FDD+ V + + G G+ Y+L Y Sbjct: 424 HQGRSSSSGHYVSWVRRKQDEWIKFDDDKVSIVTPEDILRLSG-----GGDWHIAYVLLY 478
>UBP5_MOUSE (P56399) Ubiquitin carboxyl-terminal hydrolase 5 (EC 3.1.2.15)| (Ubiquitin thioesterase 5) (Ubiquitin-specific-processing protease 5) (Deubiquitinating enzyme 5) (Isopeptidase T) Length = 858 Score = 31.6 bits (70), Expect = 1.2 Identities = 15/60 (25%), Positives = 27/60 (45%) Frame = -1 Query: 499 HVGSGPNXGHYISVVKSHNHWLFFDDETVEMTDESMVQTFFGSAQEFSGNTDNGYILFYE 320 H+G+ GHY+ +K W+ ++D+ V +++ D GYI FY+ Sbjct: 809 HMGTSTMCGHYVCHIKKEGRWVIYNDQKVCASEKP--------------PKDLGYIYFYQ 854
>EST1A_MOUSE (P61406) Telomerase-binding protein EST1A (Ever shorter telomeres 1A)| (Telomerase subunit EST1A) (EST1-like protein A) Length = 1418 Score = 31.6 bits (70), Expect = 1.2 Identities = 18/54 (33%), Positives = 28/54 (51%), Gaps = 1/54 (1%) Frame = -2 Query: 264 FFPFIATPPAPCYIE-DSVN*NNSNGKAVQP*MLFVESVFSNKEAVTSFAGGYY 106 F P +A P PCY+E S ++ K V F+E++ +E + +F GG Y Sbjct: 1099 FVPLLAAPQDPCYVEKTSDKVIAADCKRVTVLKYFLEALCGQEEPLLAFKGGKY 1152
>EST1A_HUMAN (Q86US8) Telomerase-binding protein EST1A (Ever shorter telomeres 1A)| (Telomerase subunit EST1A) (EST1-like protein A) (hSmg5/7a) Length = 1419 Score = 31.6 bits (70), Expect = 1.2 Identities = 18/54 (33%), Positives = 28/54 (51%), Gaps = 1/54 (1%) Frame = -2 Query: 264 FFPFIATPPAPCYIE-DSVN*NNSNGKAVQP*MLFVESVFSNKEAVTSFAGGYY 106 F P +A P PCY+E S ++ K V F+E++ +E + +F GG Y Sbjct: 1100 FVPLLAAPQDPCYVEKTSDKVIAADCKRVTVLKYFLEALCGQEEPLLAFKGGKY 1153
>UBP21_HUMAN (Q9UK80) Ubiquitin carboxyl-terminal hydrolase 21 (EC 3.1.2.15)| (Ubiquitin thioesterase 21) (Ubiquitin-specific-processing protease 21) (Deubiquitinating enzyme 21) (NEDD8-specific protease) Length = 565 Score = 31.2 bits (69), Expect = 1.6 Identities = 18/69 (26%), Positives = 30/69 (43%) Frame = -1 Query: 499 HVGSGPNXGHYISVVKSHNHWLFFDDETVEMTDESMVQTFFGSAQEFSGNTDNGYILFYE 320 H GS + GHY ++ + W ++D V E+ V + GY+LFY+ Sbjct: 510 HSGS-VHYGHYTALCRCQTGWHVYNDSRVSPVSENQVAS------------SEGYVLFYQ 556 Query: 319 SLAKTS*CL 293 + + CL Sbjct: 557 LMQEPPRCL 565
>RS18_CAMJE (O69301) 30S ribosomal protein S18| Length = 86 Score = 31.2 bits (69), Expect = 1.6 Identities = 11/42 (26%), Positives = 25/42 (59%) Frame = +1 Query: 7 YDDKILLRNIIPDRFRLVPQRKTTSRRRQASAAVVPTRKTRH 132 Y D +L++ + +RF+++P+R T + ++ V ++ RH Sbjct: 24 YKDTAMLKHALSERFKIMPRRLTGTSKKYQEMVEVAIKRARH 65
>UBP7_YEAST (P40453) Ubiquitin carboxyl-terminal hydrolase 7 (EC 3.1.2.15)| (Ubiquitin thioesterase 7) (Ubiquitin-specific-processing protease 7) (Deubiquitinating enzyme 7) Length = 1071 Score = 30.8 bits (68), Expect = 2.1 Identities = 20/61 (32%), Positives = 29/61 (47%), Gaps = 9/61 (14%) Frame = -1 Query: 475 GHYISVVKS---HN------HWLFFDDETVEMTDESMVQTFFGSAQEFSGNTDNGYILFY 323 GHY S+V HN W +FDDE V+ + GS + ++ + Y+LFY Sbjct: 1013 GHYTSLVNKDLEHNVNIGRSKWYYFDDEVVKADRK------HGSDKNLKISSSDVYVLFY 1066 Query: 322 E 320 E Sbjct: 1067 E 1067
>UBP21_MOUSE (Q9QZL6) Ubiquitin carboxyl-terminal hydrolase 21 (EC 3.1.2.15)| (Ubiquitin thioesterase 21) (Ubiquitin-specific processing protease 21) (Deubiquitinating enzyme 21) Length = 566 Score = 30.8 bits (68), Expect = 2.1 Identities = 18/69 (26%), Positives = 30/69 (43%) Frame = -1 Query: 499 HVGSGPNXGHYISVVKSHNHWLFFDDETVEMTDESMVQTFFGSAQEFSGNTDNGYILFYE 320 H GS + GHY ++ + W ++D V E+ V + GY+LFY+ Sbjct: 511 HSGS-VHYGHYTALCRCQTGWHVYNDSRVSPVSENQVAS------------SEGYVLFYQ 557 Query: 319 SLAKTS*CL 293 + + CL Sbjct: 558 LMQEPLRCL 566
>UBP33_HUMAN (Q8TEY7) Ubiquitin carboxyl-terminal hydrolase 33 (EC 3.1.2.15)| (Ubiquitin thioesterase 33) (Ubiquitin-specific-processing protease 33) (Deubiquitinating enzyme 33) (VHL-interacting deubiquitinating enzyme 1) Length = 942 Score = 30.4 bits (67), Expect = 2.8 Identities = 18/55 (32%), Positives = 26/55 (47%), Gaps = 2/55 (3%) Frame = -1 Query: 481 NXGHYISVVKSH--NHWLFFDDETVEMTDESMVQTFFGSAQEFSGNTDNGYILFY 323 + GHYI+ +++ N W FDD++V ES VQ Y+LFY Sbjct: 670 SSGHYIAYCRNNLNNLWYEFDDQSVTEVSESTVQ------------NAEAYVLFY 712
>UBP13_HUMAN (Q92995) Ubiquitin carboxyl-terminal hydrolase 13 (EC 3.1.2.15)| (Ubiquitin thioesterase 13) (Ubiquitin-specific-processing protease 13) (Deubiquitinating enzyme 13) (Isopeptidase T-3) (ISOT-3) Length = 863 Score = 30.4 bits (67), Expect = 2.8 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = -1 Query: 499 HVGSGPNXGHYISVVKSHNHWLFFDDETV 413 H+G+ GHYI +K W+ ++D V Sbjct: 814 HMGTSTMSGHYICHIKKEGRWVIYNDHKV 842
>UBP12_YEAST (P39538) Ubiquitin carboxyl-terminal hydrolase 12 (EC 3.1.2.15)| (Ubiquitin thioesterase 12) (Ubiquitin-specific-processing protease 12) (Deubiquitinating enzyme 12) Length = 1254 Score = 30.0 bits (66), Expect = 3.6 Identities = 22/61 (36%), Positives = 29/61 (47%), Gaps = 2/61 (3%) Frame = -1 Query: 499 HVGSGPNXGHYISVVKSH--NHWLFFDDETVEMTDESMVQTFFGSAQEFSGNTDNGYILF 326 H G G GHY + VK+ N W +FDD V T+ + + GSA Y+LF Sbjct: 1060 HYG-GLGGGHYTAYVKNFADNKWYYFDDSRV--TETAPENSIAGSA----------YLLF 1106 Query: 325 Y 323 Y Sbjct: 1107 Y 1107
>UBP8_SCHPO (Q09738) Probable ubiquitin carboxyl-terminal hydrolase 8 (EC| 3.1.2.15) (Ubiquitin thioesterase 8) (Ubiquitin-specific processing protease 8) (Deubiquitinating enzyme 8) Length = 449 Score = 29.6 bits (65), Expect = 4.7 Identities = 16/53 (30%), Positives = 20/53 (37%) Frame = -1 Query: 481 NXGHYISVVKSHNHWLFFDDETVEMTDESMVQTFFGSAQEFSGNTDNGYILFY 323 + GHYI+ N W DD T+ ES V Y+LFY Sbjct: 392 DTGHYIAYTYYQNQWFLLDDTTIVEVKESEVL------------NSQAYLLFY 432
>DXS_CHLTR (O84335) 1-deoxy-D-xylulose-5-phosphate synthase (EC 2.2.1.7)| (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) Length = 640 Score = 29.6 bits (65), Expect = 4.7 Identities = 16/37 (43%), Positives = 20/37 (54%) Frame = +3 Query: 117 PQNSSRLLYC*TPTPQKASKVEQPCHSNYSNLPNLLY 227 PQ S +Y PQK SK+ Q HS NLP+ L+ Sbjct: 187 PQGISHWMY-----PQKISKLSQKIHSWIQNLPSFLH 218
>UBP4_MOUSE (P35123) Ubiquitin carboxyl-terminal hydrolase 4 (EC 3.1.2.15)| (Ubiquitin thioesterase 4) (Ubiquitin-specific-processing protease 4) (Deubiquitinating enzyme 4) (Ubiquitous nuclear protein) Length = 962 Score = 29.6 bits (65), Expect = 4.7 Identities = 15/54 (27%), Positives = 24/54 (44%), Gaps = 2/54 (3%) Frame = -1 Query: 475 GHYISVVKS--HNHWLFFDDETVEMTDESMVQTFFGSAQEFSGNTDNGYILFYE 320 GHY + K+ + W +FDD +V + E + T Y+LFY+ Sbjct: 879 GHYTAYAKNRLNGKWYYFDDSSVSLASEDQIV------------TKAAYVLFYQ 920
>UBP4_HUMAN (Q13107) Ubiquitin carboxyl-terminal hydrolase 4 (EC 3.1.2.15)| (Ubiquitin thioesterase 4) (Ubiquitin-specific-processing protease 4) (Deubiquitinating enzyme 4) (Ubiquitous nuclear protein homolog) Length = 963 Score = 29.3 bits (64), Expect = 6.2 Identities = 15/54 (27%), Positives = 23/54 (42%), Gaps = 2/54 (3%) Frame = -1 Query: 475 GHYISVVKS--HNHWLFFDDETVEMTDESMVQTFFGSAQEFSGNTDNGYILFYE 320 GHY + K+ + W +FDD V + E + T Y+LFY+ Sbjct: 880 GHYTAYAKNKLNGKWYYFDDSNVSLASEDQIV------------TKAAYVLFYQ 921
>UBP6_HUMAN (P35125) Ubiquitin carboxyl-terminal hydrolase 6 (EC 3.1.2.15)| (Ubiquitin thioesterase 6) (Ubiquitin-specific-processing protease 6) (Deubiquitinating enzyme 6) (Proto-oncogene TRE-2) Length = 1406 Score = 29.3 bits (64), Expect = 6.2 Identities = 17/53 (32%), Positives = 25/53 (47%), Gaps = 1/53 (1%) Frame = -1 Query: 475 GHYISVVKSHN-HWLFFDDETVEMTDESMVQTFFGSAQEFSGNTDNGYILFYE 320 GHYI+ K+ N W ++D + E + +TD+ YILFYE Sbjct: 1327 GHYITYAKNPNCKWYCYNDSSCEELHPDEI------------DTDSAYILFYE 1367
>UBP19_HUMAN (O94966) Ubiquitin carboxyl-terminal hydrolase 19 (EC 3.1.2.15)| (Ubiquitin thioesterase 19) (Ubiquitin-specific-processing protease 19) (Deubiquitinating enzyme 19) (Zinc finger MYND domain-containing protein 9) (Fragment) Length = 1371 Score = 29.3 bits (64), Expect = 6.2 Identities = 22/68 (32%), Positives = 26/68 (38%), Gaps = 9/68 (13%) Frame = -1 Query: 499 HVGSGPNXGHYISVVKSHNH---------WLFFDDETVEMTDESMVQTFFGSAQEFSGNT 347 H G G GHY + + N W FDD TV DES V T + Sbjct: 1210 HYG-GMIGGHYTACARLPNDRSSQRSDVGWRLFDDSTVTTVDESQVVTRY---------- 1258 Query: 346 DNGYILFY 323 Y+LFY Sbjct: 1259 --AYVLFY 1264
>RS18_WOLSU (Q7MQZ9) 30S ribosomal protein S18| Length = 85 Score = 29.3 bits (64), Expect = 6.2 Identities = 11/42 (26%), Positives = 25/42 (59%) Frame = +1 Query: 7 YDDKILLRNIIPDRFRLVPQRKTTSRRRQASAAVVPTRKTRH 132 Y D +L++ + +R++++P+R T + +R V ++ RH Sbjct: 24 YKDVEMLKHSLSERYKIMPRRLTGNSKRWQERVEVAIKRARH 65
>RS18_WIGBR (Q8D2U3) 30S ribosomal protein S18| Length = 75 Score = 29.3 bits (64), Expect = 6.2 Identities = 18/41 (43%), Positives = 24/41 (58%), Gaps = 3/41 (7%) Frame = +1 Query: 7 YDDKILLRNIIPDRFRLVPQRKTTSR---RRQASAAVVPTR 120 Y D ILL+N I + ++VP R T +R +RQ S AV R Sbjct: 23 YKDIILLKNYITENGKIVPSRITGTRARYQRQLSRAVKRAR 63
>PROML_BRARE (Q9W735) Prominin-like protein (Fragment)| Length = 713 Score = 28.9 bits (63), Expect = 8.1 Identities = 13/42 (30%), Positives = 22/42 (52%), Gaps = 1/42 (2%) Frame = -1 Query: 295 LPAHLVISN-TVFSFHRHTSCSVLYRRFGKLE*FEWQGCSTL 173 LP H ++N T H H+ +Y + +++ + W GC TL Sbjct: 396 LPVHSSLANFTRMISHTHSQIEDIYPQIDQMDFYRWIGCITL 437
>Y423_MYCGE (P47662) Hypothetical protein MG423| Length = 561 Score = 28.9 bits (63), Expect = 8.1 Identities = 15/38 (39%), Positives = 25/38 (65%), Gaps = 4/38 (10%) Frame = -1 Query: 421 ETVEMTDESM----VQTFFGSAQEFSGNTDNGYILFYE 320 ET+E+++ S+ V + S+ F+ NTDNGYI+F + Sbjct: 125 ETIEISNHSITPFKVSSSLPSSFGFALNTDNGYIVFID 162
>EST1A_PONPY (Q5RAK6) Telomerase-binding protein EST1A (Ever shorter telomeres 1A)| (Telomerase subunit EST1A) (EST1-like protein A) Length = 1419 Score = 28.9 bits (63), Expect = 8.1 Identities = 17/54 (31%), Positives = 27/54 (50%), Gaps = 1/54 (1%) Frame = -2 Query: 264 FFPFIATPPAPCYIE-DSVN*NNSNGKAVQP*MLFVESVFSNKEAVTSFAGGYY 106 F P +A P PCY+E S ++ K V F+E++ +E + +F G Y Sbjct: 1100 FVPLLAAPQDPCYVEKTSDKVIAADCKRVTVLKYFLEALCGQEEPLLAFKDGKY 1153
>UBP14_SCHPO (Q11119) Ubiquitin carboxyl-terminal hydrolase 14 (EC 3.1.2.15)| (Ubiquitin thioesterase 14) (Ubiquitin-specific-processing protease 14) (Deubiquitinating enzyme 14) (UBA-domain-containing protein 2) Length = 775 Score = 28.9 bits (63), Expect = 8.1 Identities = 11/33 (33%), Positives = 18/33 (54%), Gaps = 4/33 (12%) Frame = -1 Query: 499 HVGSGPNXGHYISVVKSH----NHWLFFDDETV 413 H GS + GHY++ ++ W+ F+DE V Sbjct: 721 HKGSSAHAGHYVAFIRKEIDGKQQWVLFNDEKV 753 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 66,130,484 Number of Sequences: 219361 Number of extensions: 1205338 Number of successful extensions: 3055 Number of sequences better than 10.0: 51 Number of HSP's better than 10.0 without gapping: 2993 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3050 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3581144924 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
