| Clone Name | rbags16c13 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CEMA_CHLRE (Q37050) Chloroplast envelope membrane protein | 30 | 3.8 | 2 | ODP1_BUCAI (P57301) Pyruvate dehydrogenase E1 component (EC 1.2.... | 29 | 5.0 | 3 | Y1411_SYNY3 (P72725) UPF0272 protein slr1411 | 29 | 5.0 |
|---|
>CEMA_CHLRE (Q37050) Chloroplast envelope membrane protein| Length = 500 Score = 29.6 bits (65), Expect = 3.8 Identities = 14/30 (46%), Positives = 20/30 (66%) Frame = +1 Query: 295 HSISQVLLFSCWQLNLYTLLYVLVA*EIQV 384 HSI + F L+L+TLLY+L+ EIQ+ Sbjct: 373 HSIEAITNFFADLLSLFTLLYLLITLEIQI 402
>ODP1_BUCAI (P57301) Pyruvate dehydrogenase E1 component (EC 1.2.4.1)| Length = 887 Score = 29.3 bits (64), Expect = 5.0 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +2 Query: 179 LGTLDKRKNIAAQMKHVYTVGPIHVRKNYGVLVGKKE 289 +G + + KNIA Q+K + G IH+R + + V E Sbjct: 397 MGVIAEGKNIAHQIKKININGIIHIRDRFNIPVSNDE 433
>Y1411_SYNY3 (P72725) UPF0272 protein slr1411| Length = 422 Score = 29.3 bits (64), Expect = 5.0 Identities = 19/55 (34%), Positives = 28/55 (50%), Gaps = 6/55 (10%) Frame = +2 Query: 140 NMSH--ELIYRAVTSLGTLDKRKNIAAQMKHVYTV----GPIHVRKNYGVLVGKK 286 N +H L++R TSLG +++ A + TV GPI ++ YG GKK Sbjct: 323 NQNHCLNLLFRETTSLGVRVRQQQRYALEREWQTVVIPHGPIRIKVAYGYQAGKK 377 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 70,021,342 Number of Sequences: 219361 Number of extensions: 1417364 Number of successful extensions: 3853 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3775 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3853 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2909956200 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)