ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbags16c05 |
|---|---|
| Clone Library Name | barley_pub |
>EF1D_PIMBR (P93447) Elongation factor 1-delta (EF-1-delta) (Elongation factor| 1B-beta) (eEF-1B beta) Length = 225 Score = 41.2 bits (95), Expect = 0.003 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -1 Query: 689 EPANEYIQSCDIVAFNKI 636 EPANEYIQSCDIVAFNKI Sbjct: 208 EPANEYIQSCDIVAFNKI 225
>EF1D1_ORYSA (Q40680) Elongation factor 1-delta 1 (EF-1-delta 1) (Elongation| factor 1B-beta 1) (eEF-1B beta 1) Length = 228 Score = 41.2 bits (95), Expect = 0.003 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -1 Query: 689 EPANEYIQSCDIVAFNKI 636 EPANEYIQSCDIVAFNKI Sbjct: 211 EPANEYIQSCDIVAFNKI 228
>EF1D2_ARATH (Q9SI20) Elongation factor 1-delta 2 (EF-1-delta 2) (Elongation| factor 1B-beta 2) (eEF-1B beta 2) Length = 231 Score = 40.4 bits (93), Expect = 0.005 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -1 Query: 692 VEPANEYIQSCDIVAFNKI 636 VEP NEY+QSCDIVAFNKI Sbjct: 213 VEPINEYVQSCDIVAFNKI 231
>EF1D1_ARATH (P48006) Elongation factor 1-delta 1 (EF-1-delta 1) (Elongation| factor 1B-beta 1) (eEF-1B beta 1) Length = 231 Score = 40.4 bits (93), Expect = 0.005 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -1 Query: 692 VEPANEYIQSCDIVAFNKI 636 VEP NEY+QSCDIVAFNKI Sbjct: 213 VEPINEYVQSCDIVAFNKI 231
>EF1D_BETVU (O81918) Elongation factor 1-delta (EF-1-delta) (Elongation factor| 1B-beta) (eEF-1B beta) Length = 230 Score = 40.4 bits (93), Expect = 0.005 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -1 Query: 692 VEPANEYIQSCDIVAFNKI 636 VEP NEY+QSCDIVAFNKI Sbjct: 212 VEPINEYVQSCDIVAFNKI 230
>EF1D2_ORYSA (Q40682) Elongation factor 1-delta 2 (EF-1-delta 2) (Elongation| factor 1B-beta 2) (eEF-1B beta 2) Length = 225 Score = 39.7 bits (91), Expect = 0.009 Identities = 17/18 (94%), Positives = 18/18 (100%) Frame = -1 Query: 689 EPANEYIQSCDIVAFNKI 636 EPANE+IQSCDIVAFNKI Sbjct: 208 EPANEFIQSCDIVAFNKI 225
>EF1B2_ARATH (Q9SCX3) Elongation factor 1-beta 2 (EF-1-beta 2) (Elongation| factor 1B-alpha 2) (eEF-1B alpha 2) (Elongation factor 1-beta' 2) (EF-1-beta' 2) Length = 224 Score = 38.9 bits (89), Expect = 0.015 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 689 EPANEYIQSCDIVAFNKI 636 EP NEYIQSCDIVAFNKI Sbjct: 207 EPNNEYIQSCDIVAFNKI 224
>EF1B_ORYSA (P29545) Elongation factor 1-beta (EF-1-beta) (Elongation factor| 1B-alpha 2) (eEF-1B alpha) (Elongation factor 1-beta') (EF-1-beta') Length = 223 Score = 37.4 bits (85), Expect = 0.043 Identities = 15/18 (83%), Positives = 17/18 (94%) Frame = -1 Query: 689 EPANEYIQSCDIVAFNKI 636 EP NE++QSCDIVAFNKI Sbjct: 206 EPINEFVQSCDIVAFNKI 223
>EF1B_WHEAT (P29546) Elongation factor 1-beta (EF-1-beta) (Elongation factor| 1B-alpha 2) (eEF-1B alpha) (Elongation factor 1-beta') (EF-1-beta') Length = 215 Score = 37.0 bits (84), Expect = 0.057 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -1 Query: 686 PANEYIQSCDIVAFNKI 636 P NEY+QSCDIVAFNKI Sbjct: 199 PINEYVQSCDIVAFNKI 215
>EF1B1_ARATH (Q84WM9) Elongation factor 1-beta 1 (EF-1-beta 1) (Elongation| factor 1B-alpha 1) (eEF-1B alpha 1) (Elongation factor 1-beta' 1) (EF-1-beta' 1) Length = 228 Score = 35.0 bits (79), Expect = 0.22 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -1 Query: 689 EPANEYIQSCDIVAFNKI 636 EP NEYIQS DIVAFNKI Sbjct: 211 EPNNEYIQSVDIVAFNKI 228
>RN_BACIN (P00649) Ribonuclease precursor (EC 3.1.27.-) (Binase) (RNase Bi)| Length = 162 Score = 32.3 bits (72), Expect = 1.4 Identities = 21/59 (35%), Positives = 30/59 (50%) Frame = +2 Query: 173 KKFGSFGTFIVVQNAVLFTRFI*AQAQNELPLTLTQTKDSLNAVWQATDYIFLLGLVES 349 KK S T + A+LF+ FI QA E PLT T T ++ A Q T + L ++ + Sbjct: 2 KKISSVFTMFALIAAILFSGFIPQQAYAETPLTQTATNET--ATIQLTSDVHTLAVINT 58
>YAS5_SCHPO (Q10141) Hypothetical protein C3H8.05c precursor| Length = 1073 Score = 30.4 bits (67), Expect = 5.3 Identities = 12/44 (27%), Positives = 25/44 (56%), Gaps = 3/44 (6%) Frame = +2 Query: 257 ELPLTLTQTKDSLNAVWQATDYIFLLGL---VESTVVKQVKTIN 379 +LPLTL D + ++ +DY++++G+ E + Q+ +N Sbjct: 660 DLPLTLQSPSDEFSTIYAWSDYLYIVGIDMETEQPTLNQILEVN 703 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 98,244,856 Number of Sequences: 219361 Number of extensions: 1993748 Number of successful extensions: 3928 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 3823 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3928 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 6856295237 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
