| Clone Name | rbags15n03 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | BXD_CLOBO (P19321) Botulinum neurotoxin type D precursor (EC 3.4... | 28 | 5.2 | 2 | YDBJ_SCHPO (Q10369) Hypothetical protein C22E12.19 in chromosome I | 28 | 6.8 | 3 | GBRP_MOUSE (Q8QZW7) Gamma-aminobutyric-acid receptor pi subunit ... | 28 | 6.8 | 4 | OR65A_DROME (P82982) Putative odorant receptor 65a | 27 | 8.9 |
|---|
>BXD_CLOBO (P19321) Botulinum neurotoxin type D precursor (EC 3.4.24.69)| (BoNT/D) (Bontoxilysin D) [Contains: Botulinum neurotoxin D light chain; Botulinum neurotoxin D heavy chain] Length = 1276 Score = 28.1 bits (61), Expect = 5.2 Identities = 15/43 (34%), Positives = 21/43 (48%) Frame = +1 Query: 118 ISEQGQNSECMSSLLTLSCNSFLNRY*KTLLAATPNRKEHETC 246 I GQN E +L LS S ++ + K L T N ++ TC Sbjct: 408 IENSGQNIERNPALQKLSSESVVDLFTKVCLRLTKNSRDDSTC 450
>YDBJ_SCHPO (Q10369) Hypothetical protein C22E12.19 in chromosome I| Length = 661 Score = 27.7 bits (60), Expect = 6.8 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = -1 Query: 274 SVGSRRKKLHMSHVPSDSESQRAMSFSIYSGMSCMIM 164 S+ + + H H+P E + A+ FS+ GM+ M M Sbjct: 515 SISAVDESAHQGHLPGWDEKEEALIFSLAQGMNPMKM 551
>GBRP_MOUSE (Q8QZW7) Gamma-aminobutyric-acid receptor pi subunit precursor| (GABA(A) receptor) Length = 440 Score = 27.7 bits (60), Expect = 6.8 Identities = 10/22 (45%), Positives = 16/22 (72%) Frame = -1 Query: 205 MSFSIYSGMSCMIMLTRSSCIQ 140 MS+S+Y C+ +LT+ +CIQ Sbjct: 1 MSYSLYLAFLCLSLLTQRTCIQ 22
>OR65A_DROME (P82982) Putative odorant receptor 65a| Length = 417 Score = 27.3 bits (59), Expect = 8.9 Identities = 13/53 (24%), Positives = 27/53 (50%), Gaps = 1/53 (1%) Frame = -3 Query: 167 NVNKELMHSEFCPCSEMRQCPLV*LVNPTDTV-MNRSIFVIFRCHSLFLYVCN 12 NV + +H +FC + Q PL+ +P + +F++ +C+S+ + N Sbjct: 362 NVGSKSIHRQFCFFIQRAQKPLIMKASPFPPFNLENYMFILKQCYSILTILAN 414 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 48,826,070 Number of Sequences: 219361 Number of extensions: 816675 Number of successful extensions: 1495 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1464 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1495 length of database: 80,573,946 effective HSP length: 111 effective length of database: 56,224,875 effective search space used: 1349397000 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)