| Clone Name | rbags16b23 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PHAR1_MOUSE (Q2M3X8) Phosphatase and actin regulator 1 | 31 | 3.2 | 2 | PHAR1_RAT (P62024) Phosphatase and actin regulator 1 | 30 | 5.4 | 3 | PHAR1_HUMAN (Q9C0D0) Phosphatase and actin regulator 1 | 30 | 5.4 | 4 | PP1RA_MACMU (Q5TM61) Serine/threonine-protein phosphatase 1 regu... | 29 | 9.2 | 5 | PP1RA_HUMAN (Q96QC0) Serine/threonine-protein phosphatase 1 regu... | 29 | 9.2 |
|---|
>PHAR1_MOUSE (Q2M3X8) Phosphatase and actin regulator 1| Length = 580 Score = 30.8 bits (68), Expect = 3.2 Identities = 20/60 (33%), Positives = 31/60 (51%), Gaps = 1/60 (1%) Frame = +2 Query: 398 DHG*XFASFSTSMPKIQLETEKLQVPRKPCRFLQLQINEGHTSRKPGIPHSL-ALSVKLN 574 ++G +S S+P + E E + +PR PC + LQ ++ PG P L L VKL+ Sbjct: 179 ENGQSLSSSQLSLPALS-EMEPVPMPRDPCSYEVLQASDIMDGPDPGAPVKLPCLPVKLS 237
>PHAR1_RAT (P62024) Phosphatase and actin regulator 1| Length = 580 Score = 30.0 bits (66), Expect = 5.4 Identities = 20/59 (33%), Positives = 30/59 (50%), Gaps = 1/59 (1%) Frame = +2 Query: 401 HG*XFASFSTSMPKIQLETEKLQVPRKPCRFLQLQINEGHTSRKPGIPHSL-ALSVKLN 574 +G +S S+P + E E + +PR PC + LQ ++ PG P L L VKL+ Sbjct: 180 NGQSLSSSQLSLPALS-EMEPVPMPRDPCSYEVLQASDIMDGPDPGAPVKLPCLPVKLS 237
>PHAR1_HUMAN (Q9C0D0) Phosphatase and actin regulator 1| Length = 580 Score = 30.0 bits (66), Expect = 5.4 Identities = 20/60 (33%), Positives = 31/60 (51%), Gaps = 1/60 (1%) Frame = +2 Query: 398 DHG*XFASFSTSMPKIQLETEKLQVPRKPCRFLQLQINEGHTSRKPGIPHSL-ALSVKLN 574 ++G +S S+P + E E + +PR PC + LQ ++ PG P L L VKL+ Sbjct: 179 ENGQSLSSSQLSLPALS-EMEPVPMPRDPCSYEVLQPSDIMDGPDPGAPVKLPCLPVKLS 237
>PP1RA_MACMU (Q5TM61) Serine/threonine-protein phosphatase 1 regulatory subunit| 10 (MHC class I region proline-rich protein CAT53) Length = 940 Score = 29.3 bits (64), Expect = 9.2 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -1 Query: 326 GKHHRPHESPRGGNNESSPH 267 G HRPHE P GG SS H Sbjct: 749 GGGHRPHEGPGGGMGNSSGH 768
>PP1RA_HUMAN (Q96QC0) Serine/threonine-protein phosphatase 1 regulatory subunit| 10 (Phosphatase 1 nuclear targeting subunit) (MHC class I region proline-rich protein CAT53) (FB19 protein) (PP1-binding protein of 114 kDa) (p99) Length = 940 Score = 29.3 bits (64), Expect = 9.2 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -1 Query: 326 GKHHRPHESPRGGNNESSPH 267 G HRPHE P GG SS H Sbjct: 748 GGGHRPHEGPGGGMGNSSGH 767 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 87,173,238 Number of Sequences: 219361 Number of extensions: 1780695 Number of successful extensions: 3680 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 3572 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3679 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5310515667 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)