| Clone Name | rbags16b13 |
|---|---|
| Clone Library Name | barley_pub |
>VENV_FOWPV (P36316) Major envelope protein (43 kDa protein) (p43K)| Length = 377 Score = 30.8 bits (68), Expect = 0.87 Identities = 10/28 (35%), Positives = 21/28 (75%) Frame = +2 Query: 215 CCHVNT*PQGSSIINRLLGLLSRTHCFL 298 CC+++T P+G+ I+NRL+ + S+ ++ Sbjct: 54 CCNLSTNPEGTDILNRLIDVSSKVSVYI 81
>YCF1_ARATH (P56785) Hypothetical 213.7 kDa protein ycf1| Length = 1786 Score = 28.9 bits (63), Expect = 3.3 Identities = 17/49 (34%), Positives = 28/49 (57%), Gaps = 3/49 (6%) Frame = +3 Query: 21 NKTVFVRKYIVMFL--HVLRLAMVG-AQIWIRPSQSLKTPKTYRSNLFK 158 NK +FV V +L H+L + VG +WI+ + S+++ RSN +K Sbjct: 166 NKMLFVTSSFVGWLIGHILFMKWVGLVLVWIQQNNSIRSNVVIRSNKYK 214
>TONB_PSEAE (Q51368) Protein tonB| Length = 342 Score = 28.5 bits (62), Expect = 4.3 Identities = 15/50 (30%), Positives = 26/50 (52%), Gaps = 6/50 (12%) Frame = +3 Query: 69 LRLAMVGAQIWIRPSQSL------KTPKTYRSNLFKLT*CGSMVLQPPAA 200 + +A++GA +W+ P+ + + PKT + N +L QPPAA Sbjct: 97 MHVAIIGALVWVMPTPAELNLGHGELPKTMQVNFVQLEKKAEPTPQPPAA 146
>DPOLA_OXYTR (Q27152) DNA polymerase alpha catalytic subunit (EC 2.7.7.7)| Length = 1513 Score = 28.1 bits (61), Expect = 5.6 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = -2 Query: 90 LPPLPNAVHVKTSRCIFGRTR 28 +PPLP+ + T CIFG T+ Sbjct: 475 MPPLPSTIQGNTFECIFGSTQ 495
>HSP6C_DROME (P22979) Heat shock protein 67B3 (Heat shock 18 kDa protein)| Length = 169 Score = 27.7 bits (60), Expect = 7.4 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -3 Query: 203 VGGWRLQYHGPTLS 162 VGGW QYHG T+S Sbjct: 144 VGGWSSQYHGSTIS 157
>ARGE_SHIFL (P59600) Acetylornithine deacetylase (EC 3.5.1.16)| (Acetylornithinase) (AO) (N-acetylornithinase) (NAO) Length = 383 Score = 27.7 bits (60), Expect = 7.4 Identities = 16/43 (37%), Positives = 25/43 (58%), Gaps = 2/43 (4%) Frame = +2 Query: 158 VNLMWVHGTAAASRQLVSRCC--HVNT*PQGSSIINRLLGLLS 280 +NL +HG A++R + CC H++ PQ +N L GLL+ Sbjct: 239 LNLGHIHGGDASNR--ICACCELHMDIRPQPGMTLNELNGLLN 279
>ARCA_BURPS (Q63U73) Arginine deiminase (EC 3.5.3.6) (ADI) (Arginine| dihydrolase) (AD) Length = 418 Score = 27.7 bits (60), Expect = 7.4 Identities = 12/24 (50%), Positives = 17/24 (70%), Gaps = 1/24 (4%) Frame = -2 Query: 105 ESKFVLPPLPNAVHVKTSRC-IFG 37 +S FVLPPLPN + + + C I+G Sbjct: 150 KSSFVLPPLPNMMFTRDTSCWIYG 173
>ARCA_BURMA (Q62KD9) Arginine deiminase (EC 3.5.3.6) (ADI) (Arginine| dihydrolase) (AD) Length = 418 Score = 27.7 bits (60), Expect = 7.4 Identities = 12/24 (50%), Positives = 17/24 (70%), Gaps = 1/24 (4%) Frame = -2 Query: 105 ESKFVLPPLPNAVHVKTSRC-IFG 37 +S FVLPPLPN + + + C I+G Sbjct: 150 KSSFVLPPLPNMMFTRDTSCWIYG 173
>THIC_BACTN (Q8AA15) Thiamine biosynthesis protein thiC| Length = 565 Score = 27.3 bits (59), Expect = 9.6 Identities = 9/22 (40%), Positives = 17/22 (77%) Frame = -3 Query: 158 LEEIASISFRGFKRLARPNPNL 93 +E++ S+SF G +++A PNP + Sbjct: 30 VEQVPSVSFEGEEKIATPNPEV 51
>PDE3B_HUMAN (Q13370) cGMP-inhibited 3',5'-cyclic phosphodiesterase B (EC| 3.1.4.17) (Cyclic GMP-inhibited phosphodiesterase B) (CGI-PDE B) (CGIPDE1) (CGIP1) Length = 1112 Score = 27.3 bits (59), Expect = 9.6 Identities = 11/27 (40%), Positives = 14/27 (51%), Gaps = 2/27 (7%) Frame = +1 Query: 55 CFYM--YCVWQWWEHKFGFGRANLLKP 129 C Y+ + VWQWW +G G A P Sbjct: 160 CCYLGDFLVWQWWSWPWGDGDAGSAAP 186
>RHL_MACMU (Q28849) RH-like protein (Rhesus-like protein)| Length = 416 Score = 27.3 bits (59), Expect = 9.6 Identities = 12/42 (28%), Positives = 23/42 (54%) Frame = +2 Query: 155 QVNLMWVHGTAAASRQLVSRCCHVNT*PQGSSIINRLLGLLS 280 ++N+ ++H A A +S CHV P + ++ + GL+S Sbjct: 263 KINMTYMHNAALAGGVALSASCHVIHSPWIAMVLGLVAGLIS 304 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 48,412,783 Number of Sequences: 219361 Number of extensions: 855798 Number of successful extensions: 1826 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 1813 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1826 length of database: 80,573,946 effective HSP length: 89 effective length of database: 61,050,817 effective search space used: 1465219608 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)