| Clone Name | rbags15l24 |
|---|---|
| Clone Library Name | barley_pub |
>BTG2_HUMAN (P78543) BTG2 protein (NGF-inducible anti-proliferative protein| PC3) Length = 158 Score = 30.0 bits (66), Expect = 1.4 Identities = 14/33 (42%), Positives = 25/33 (75%) Frame = +1 Query: 199 ISSDLKTRGCY*QQRVRLYTRGVLKKARAESFK 297 +SS L+TRGC +QR+++++ G L++A E +K Sbjct: 20 LSSLLRTRGCVSEQRLKVFS-GALQEALTEHYK 51
>MAK5_YEAST (P38112) ATP-dependent RNA helicase MAK5 (EC 3.6.1.-) (Maintenance| of killer protein 5) Length = 773 Score = 29.6 bits (65), Expect = 1.9 Identities = 17/56 (30%), Positives = 27/56 (48%) Frame = +1 Query: 58 HSTQTTKHKLHVSSDIKQKKRKNKTVSSS*FRTAHKQPINTSFAGS*ISSDLKTRG 225 HS+ T K++L KQ+ K KT++ H P + + I+SD+ RG Sbjct: 494 HSSMTQKNRLKSLERFKQQSAKQKTIN-------HSNPDSVQLSTVLIASDVAARG 542
>SC11A_RAT (O88457) Sodium channel protein type 11 alpha subunit (Sodium channel| protein type XI alpha subunit) (Voltage-gated sodium channel alpha subunit Nav1.9) (Sensory neuron sodium channel 2) (NaN) Length = 1765 Score = 29.6 bits (65), Expect = 1.9 Identities = 23/79 (29%), Positives = 41/79 (51%), Gaps = 6/79 (7%) Frame = -2 Query: 320 TNSWC---LRILKDSALAFLRTPRVYNRTLCC**QPLVFKSLEIYEPAKLV---LIGCLX 159 T++WC I+ S L+ + P + + +PL ++L +E K+V LI + Sbjct: 1097 TSAWCWLDFLIVVVSVLSLMNLPSLKSFRTLRALRPL--RALSQFEGMKVVVYALISAIP 1154 Query: 158 AVLNQLEETVLFFLFFCFI 102 A+LN L ++F+L FC + Sbjct: 1155 AILNVLLVCLIFWLVFCIL 1173
>SC11A_HUMAN (Q9UI33) Sodium channel protein type 11 alpha subunit (Sodium channel| protein type XI alpha subunit) (Voltage-gated sodium channel alpha subunit Nav1.9) (Sensory neuron sodium channel 2) (Peripheral nerve sodium channel 5) (hNaN) Length = 1791 Score = 28.5 bits (62), Expect = 4.1 Identities = 15/40 (37%), Positives = 25/40 (62%), Gaps = 3/40 (7%) Frame = -2 Query: 212 KSLEIYEPAKLV---LIGCLXAVLNQLEETVLFFLFFCFI 102 ++L +E K+V LIG + A+LN L ++F+L FC + Sbjct: 1156 RALSQFEGMKVVVNALIGAIPAILNVLLVCLIFWLVFCIL 1195
>WNK3_HUMAN (Q9BYP7) Serine/threonine-protein kinase WNK3 (EC 2.7.11.1)| (Protein kinase with no lysine 3) (Protein kinase, lysine-deficient 3) Length = 1743 Score = 28.1 bits (61), Expect = 5.4 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = -2 Query: 314 SWCLRILKDSALAFLRTPRVYNRTLCC 234 SWC +ILK RTP + +R L C Sbjct: 252 SWCRQILKGLQFLHTRTPPIIHRDLKC 278
>WNK2_HUMAN (Q9Y3S1) Serine/threonine-protein kinase WNK2 (EC 2.7.11.1)| (Protein kinase with no lysine 2) (Protein kinase, lysine-deficient 2) Length = 2297 Score = 28.1 bits (61), Expect = 5.4 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = -2 Query: 314 SWCLRILKDSALAFLRTPRVYNRTLCC 234 SWC +ILK RTP + +R L C Sbjct: 300 SWCRQILKGLLFLHTRTPPIIHRDLKC 326
>WNK1_RAT (Q9JIH7) Serine/threonine-protein kinase WNK1 (EC 2.7.11.1)| (Protein kinase with no lysine 1) (Protein kinase, lysine-deficient 1) Length = 2126 Score = 28.1 bits (61), Expect = 5.4 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = -2 Query: 314 SWCLRILKDSALAFLRTPRVYNRTLCC 234 SWC +ILK RTP + +R L C Sbjct: 326 SWCRQILKGLQFLHTRTPPIIHRDLKC 352
>WNK1_MOUSE (P83741) Serine/threonine-protein kinase WNK1 (EC 2.7.11.1)| (Protein kinase with no lysine 1) (Protein kinase, lysine-deficient 1) Length = 2377 Score = 28.1 bits (61), Expect = 5.4 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = -2 Query: 314 SWCLRILKDSALAFLRTPRVYNRTLCC 234 SWC +ILK RTP + +R L C Sbjct: 326 SWCRQILKGLQFLHTRTPPIIHRDLKC 352
>WNK1_HUMAN (Q9H4A3) Serine/threonine-protein kinase WNK1 (EC 2.7.11.1)| (Protein kinase with no lysine 1) (Protein kinase, lysine-deficient 1) (Kinase deficient protein) Length = 2382 Score = 28.1 bits (61), Expect = 5.4 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = -2 Query: 314 SWCLRILKDSALAFLRTPRVYNRTLCC 234 SWC +ILK RTP + +R L C Sbjct: 326 SWCRQILKGLQFLHTRTPPIIHRDLKC 352
>BTG2_MOUSE (Q04211) BTG2 protein (NGF-inducible protein TIS21)| Length = 158 Score = 27.7 bits (60), Expect = 7.1 Identities = 13/33 (39%), Positives = 24/33 (72%) Frame = +1 Query: 199 ISSDLKTRGCY*QQRVRLYTRGVLKKARAESFK 297 +SS L+TRGC +QR+++++R L+ A + +K Sbjct: 20 LSSLLRTRGCVSEQRLKVFSR-ALQDALTDHYK 51
>SC11A_MOUSE (Q9R053) Sodium channel protein type 11 alpha subunit (Sodium channel| protein type XI alpha subunit) (Voltage-gated sodium channel alpha subunit Nav1.9) (Sensory neuron sodium channel 2) (NaN) Length = 1765 Score = 27.3 bits (59), Expect = 9.2 Identities = 22/79 (27%), Positives = 40/79 (50%), Gaps = 6/79 (7%) Frame = -2 Query: 320 TNSWC---LRILKDSALAFLRTPRVYNRTLCC**QPLVFKSLEIYEPAKLV---LIGCLX 159 T++WC I+ S L+ P + + +PL ++L +E K+V L+ + Sbjct: 1098 TSAWCWLDFLIVVVSVLSLTNLPNLKSFRNLRALRPL--RALSQFEGMKVVVNALMSAIP 1155 Query: 158 AVLNQLEETVLFFLFFCFI 102 A+LN L ++F+L FC + Sbjct: 1156 AILNVLLVCLIFWLIFCIL 1174 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 43,316,942 Number of Sequences: 219361 Number of extensions: 655860 Number of successful extensions: 1290 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 1280 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1290 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 1407308304 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)